SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001654 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001654
Domain Number 1 Region: 95-200
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000136
Family C1 set domains (antibody constant domain-like) 0.064
Further Details:      
 
Domain Number 2 Region: 21-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000275
Family I set domains 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001654   Gene: ENSGGOG00000001681   Transcript: ENSGGOT00000001690
Sequence length 273
Comment pep:known_by_projection chromosome:gorGor3.1:9:5546499:5604198:1 gene:ENSGGOG00000001681 transcript:ENSGGOT00000001690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIFLLLMLSLELQLHQIAALFTVTVPKELYIIEHGSNVTLECNFDTGSHVNLGAITASLQ
KVENDTSPHRERATLLEEQLPLGKALFHIPQVQVRDEGQYQCIIIYGVAWDYKYLTLKVK
ASYRKINTHILKVPETDEVELTCQATGYPLAEVSWPNVSVPANTSHSRTPEGLYQVTSVL
RLKPPPGRNFSCMFWNTHVRELTLASIDLQSQMEHRTHRTWLLHIFIPSCIIAFIFIATV
IALRKQLCQKLYSSKDTTKRPVPTTNREVNSAV
Download sequence
Identical sequences ENSGGOP00000001654 ENSGGOP00000001654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]