SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001672 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001672
Domain Number 1 Region: 38-155
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.7e-38
Family Frizzled cysteine-rich domain 0.0000573
Further Details:      
 
Domain Number 2 Region: 172-282
Classification Level Classification E-value
Superfamily TIMP-like 0.00000000000000424
Family Netrin-like domain (NTR/C345C module) 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001672   Gene: ENSGGOG00000001696   Transcript: ENSGGOT00000001709
Sequence length 295
Comment pep:known_by_projection chromosome:gorGor3.1:4:164071619:164080114:-1 gene:ENSGGOG00000001696 transcript:ENSGGOT00000001709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQGPGSLLLLFLASHCCLGSARGLFLFGQPDFSYKRSNCKPIPANLQLCHGIEYQNMRL
PNLLGHETMKEVLEQAGAWIPLVMKQCHPDTKKFLCSLFAPVCLDDLDETIQPCHSLCVQ
VKDRCAPVMSAFGFPWPDMLECDRFPQDNDLCIPLASSDHLLPATEEAPKVCEACKNKND
DDNDIMETLCKNDFALKIKVKEITYINRDTKIILETKSKTIYKLNGVSERDLKKSVLWLK
DSLQCTCEEMNDINAPYLVMGQKQGGELVITSVKRWQKGQREFKRISRSIRKLQC
Download sequence
Identical sequences A0A140VJU3 G3QH51 H2QQB0 Q96HF1
ENSP00000274063 ENSPTRP00000028381 ENSPTRP00000028381 ENSP00000274063 gi|48475052|ref|NP_003004.1| ENSGGOP00000001672 NP_003004.1.87134 NP_003004.1.92137 XP_004040573.1.27298 9598.ENSPTRP00000028381 9606.ENSP00000274063 ENSP00000274063 ENSGGOP00000001672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]