SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001695 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001695
Domain Number 1 Region: 140-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000025
Family C1 set domains (antibody constant domain-like) 0.037
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000001695
Domain Number - Region: 63-147
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0034
Family I set domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001695   Gene: ENSGGOG00000001722   Transcript: ENSGGOT00000001733
Sequence length 271
Comment pep:known_by_projection chromosome:gorGor3.1:3:112113558:112143271:-1 gene:ENSGGOG00000001722 transcript:ENSGGOT00000001733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAPRLLISIIIMVSASSSSCMDGKQMTQNYSTIFAEGNISQPVLMDTNAVLCFPPIALR
NLIIITWEIILRDQPSCTKAYRKETNETKETNCTVERITWVSRPDQNSDLQIRPVDTTHD
GYYRGIVVTPDGNFHRGYHLQVLVTPEVTLFQSRNRTAVCKAVAGKPAAQISWIPEGSIL
ATKQEYWGNGTVTVKSTCHWEGHKSTVTCHVSHLTGNKSLSVKLNSGLRTSGSPALSLLI
ILYVKLSLFVVILVTTGFVFFQRINHVRKVL
Download sequence
Identical sequences G3QH72
ENSGGOP00000001695 ENSGGOP00000001695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]