SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001749 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001749
Domain Number 1 Region: 27-64
Classification Level Classification E-value
Superfamily Carbonic anhydrase 0.0000000196
Family Carbonic anhydrase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001749   Gene: ENSGGOG00000001778   Transcript: ENSGGOT00000001787
Sequence length 193
Comment pep:novel chromosome:gorGor3.1:X:15653428:15667836:1 gene:ENSGGOG00000001778 transcript:ENSGGOT00000001787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQPPASTSGIMGTLSSWNLKILQINQLHLVHWNAVKFENFEDAALEENGLAVIGVFLKI
SETSGSPVSTGRPKPLARKPRPAQKHWVLQSRPFLSSQVQENCKVTYHRKHWVRIRPLPT
TPPSWDYALICIREMVPACIHVPREMVPEAWRCFPNRLPLLSNIRPDFSKAPLAYMKRWL
WTARHPHSLSAAW
Download sequence
Identical sequences ENSGGOP00000001749 ENSGGOP00000001749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]