SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001819 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001819
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 80-122
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000183
Family Hairy Orange domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001819   Gene: ENSGGOG00000001846   Transcript: ENSGGOT00000001857
Sequence length 148
Comment pep:known_by_projection chromosome:gorGor3.1:1:6492897:6493871:-1 gene:ENSGGOG00000001846 transcript:ENSGGOT00000001857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVL
EMTVRFLQELPASSWPTAAPLPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLW
RRAATATLDGGRAGDSSGPCGPGLWRPW
Download sequence
Identical sequences ENSGGOP00000001819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]