SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000001903 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000001903
Domain Number 1 Region: 327-608
Classification Level Classification E-value
Superfamily Kelch motif 6.54e-86
Family Kelch motif 0.000000000024
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 5.76e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000001903   Gene: ENSGGOG00000001935   Transcript: ENSGGOT00000001945
Sequence length 624
Comment pep:known_by_projection chromosome:gorGor3.1:19:10681637:10698426:-1 gene:ENSGGOG00000001935 transcript:ENSGGOT00000001945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPDPRPSGAGACCRFLPLQSQCPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYQDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCVELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACINWVKYDCEQRRFYVQALLRAVRCHSLTPNFLQMQLQKCEILQSDSRCKDY
LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTRMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences A0A024R7C0 G3QHR9 H2QFB9 Q14145
NP_036421.2.87134 NP_036421.2.92137 NP_987096.1.87134 NP_987096.1.92137 XP_003809635.1.60992 XP_004060046.1.27298 XP_004060047.1.27298 XP_005260230.1.92137 XP_005260231.1.92137 XP_008960095.1.60992 XP_008960096.1.60992 XP_009432858.1.37143 XP_009432859.1.37143 XP_011526754.1.92137 XP_018871320.1.27298 XP_018871321.1.27298 ENSP00000171111 ENSP00000377245 ENSP00000171111 ENSPTRP00000017850 ENSGGOP00000001903 ENSGGOP00000001903 ENSPTRP00000017850 HR6007 gi|22027642|ref|NP_036421.2| gi|45269145|ref|NP_987096.1| ENSP00000171111 ENSP00000377245 9598.ENSPTRP00000017850 9606.ENSP00000171111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]