SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002061 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002061
Domain Number 1 Region: 39-150
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000369
Family V set domains (antibody variable domain-like) 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002061   Gene: ENSGGOG00000002093   Transcript: ENSGGOT00000002106
Sequence length 228
Comment pep:known_by_projection chromosome:gorGor3.1:11:116058487:116078063:-1 gene:ENSGGOG00000002093 transcript:ENSGGOT00000002106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAGDGGKAPARWLGTGFLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG
FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD
LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILV
LLIKKLIIFILKKTQEKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV
Download sequence
Identical sequences G3QI59
XP_004052254.1.27298 ENSGGOP00000002061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]