SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002105 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002105
Domain Number 1 Region: 974-1056
Classification Level Classification E-value
Superfamily Immunoglobulin 1.2e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 1060-1147
Classification Level Classification E-value
Superfamily Immunoglobulin 3.44e-18
Family I set domains 0.043
Further Details:      
 
Domain Number 3 Region: 673-731
Classification Level Classification E-value
Superfamily BPTI-like 5.72e-16
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0033
Further Details:      
 
Domain Number 4 Region: 840-920
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000457
Family I set domains 0.014
Further Details:      
 
Domain Number 5 Region: 228-286
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000116
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 6 Region: 292-350
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000275
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 7 Region: 412-464
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000275
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 8 Region: 349-406
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000366
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002105   Gene: ENSGGOG00000002134   Transcript: ENSGGOT00000002150
Sequence length 1203
Comment pep:known_by_projection chromosome:gorGor3.1:14:54458471:54517107:1 gene:ENSGGOG00000002134 transcript:ENSGGOT00000002150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSCPDGARDFRAEQCAEFDGAEFQGRRYRWLPYYGAPNKCELNCIPKGENFYYKHREAVV
DGTPCEPGKRDVCVDGSCRVVGCDHELDSSKQEDKCLRCGGDGTTCYPVAGTFDANDLSR
GYNQILIVPVGATSILIEEAAASRNFLAVKNVRGEYYLNGHWTIEAARALPAASTILHYE
RGAEGDLAPERLHARGPTSEPLVIELISQEPNPGVHYEYHLPLRRPGPGPGFSWSHGSWS
DCSAECGGGHQSRLVFCTIDHEAYPDHMCQRQPRPADRRSCNLHPCPETKRWKAGPWAPC
SASCGGGSQSRSVYCISSDGAGIQEAVEEAECAGLPGKPPAIQACNLQRCAAWSPEPWGE
CSVSCGTGIRKRSVTCRGERGSLLHTAACSLEDRPPLTEPCVHEDCPLLSDQAWHVGTWG
LCSKSCSSGTRRRQVICAIGPPSHCGSLQHSKPVDVEPCNTQPCHLPQEVPSMQDVHTPA
SNPWMPLGPQESPASDSRGQWWAAQEHPSARGDHRGERGDPRGDQGTHLSALGPAPSLQQ
PPYQQPLRSGSGPHDCRHSPHGCCPDGHTASLGPQWQGCPGAPCQQSRYGCCPDRVSVAE
GPHHAGCTKSYGGDSTGGRPRSRAVASTVHNTHQPHAQQNEPSECRGSQFGCCYDNVATA
AGPLGEGCVGQPSHAYPVRCLLPSAHGSCADWAARWYFVASVGQCNRFWYGCHGNANNFA
SEQECMSSCQGSLHGPRRPQPGASGRSTHTDGGGSSPAGKQEPSQHRTGAAVQRKPWPSG
GLWRQDQQPGPGEAPHTQAFGEWPWGQELGSRAPGLGGDAGSPAPPFHSSSYRISLAGMK
PSLVQAALGQLVWLSCSDDTAPESQAAWQKDGQPISSDRHRLQSDGSLIIHPLQAEDAGT
YSCGSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDFGQAGAAGPLGAIPSS
HPQPANRLRLDQNQPRVVDASPGQRIRMTCRAEGFPPPAIEWQRDGQPVSSPRHQLQPDG
SLVISRVAVEDGGFYTCVAFNGQDQDQRWVQLRVLGELTISGLLPTVTVPEGDTARLLCV
VAGESVNIRWSRNGLPVQADGHRVHQSPDGTLLIYNLRARDEGSYTCSAYQGSQAVSRST
EVKVVSPAPTAQPRDPGRDCIDQPELANCDLILQAQLCGNEYYSSFCCASCSRFQPHAQP
IWQ
Download sequence
Identical sequences ENSGGOP00000002105 ENSGGOP00000002105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]