SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002153 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002153
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily POZ domain 4.32e-22
Family BTB/POZ domain 0.0000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002153   Gene: ENSGGOG00000002188   Transcript: ENSGGOT00000002199
Sequence length 64
Comment pep:novel chromosome:gorGor3.1:8:72351104:72365281:-1 gene:ENSGGOG00000002188 transcript:ENSGGOT00000002199 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAAN
FLDC
Download sequence
Identical sequences ENSGGOP00000002153 ENSGGOP00000002153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]