SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002183 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002183
Domain Number 1 Region: 179-254
Classification Level Classification E-value
Superfamily Homeodomain-like 8.13e-27
Family Homeodomain 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002183   Gene: ENSGGOG00000002217   Transcript: ENSGGOT00000002229
Sequence length 270
Comment pep:known_by_projection chromosome:gorGor3.1:7:27392461:27394755:-1 gene:ENSGGOG00000002217 transcript:ENSGGOT00000002229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSG
SGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPPPDPLPCSAVAPSPGSDSHHGGKN
SLSNSSGASANAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWM
RKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK
IWFQNRRMKWKKDNKLKSMSMAAAGGAFRP
Download sequence
Identical sequences A0A2J8VDT4 A0A2K5VUP4 A0A2K6DNI0 A9L940 G3QIH3 H2QUB6
ENSGGOP00000002183 ENSGGOP00000002183 ENSMMUP00000017686 ENSMMUP00000017686 ENSPANP00000007073 ENSPTRP00000032498 XP_004045268.1.27298 ENSPTRP00000032498 9544.ENSMMUP00000017686 9598.ENSPTRP00000032498 9600.ENSPPYP00000019843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]