SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002253 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002253
Domain Number 1 Region: 992-1214
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.15e-52
Family Complement components 0.00077
Further Details:      
 
Domain Number 2 Region: 1436-1586
Classification Level Classification E-value
Superfamily TIMP-like 4.71e-40
Family Netrin-like domain (NTR/C345C module) 0.000000101
Further Details:      
 
Domain Number 3 Region: 1284-1437
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.53e-30
Family Alpha-macroglobulin receptor domain 0.0019
Further Details:      
 
Domain Number 4 Region: 679-750
Classification Level Classification E-value
Superfamily Anaphylotoxins (complement system) 7.98e-21
Family Anaphylotoxins (complement system) 0.0000108
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002253
Domain Number - Region: 818-850
Classification Level Classification E-value
Superfamily E set domains 0.0588
Family SVA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002253   Gene: ENSGGOG00000002285   Transcript: ENSGGOT00000002302
Sequence length 1587
Comment pep:known_by_projection chromosome:gorGor3.1:9:103707641:103806604:-1 gene:ENSGGOG00000002285 transcript:ENSGGOT00000002302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKKMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLAGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKAIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISI
GPRCVKAFTECCVVASQLRANNSHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNSGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETSFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLNIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQNPPIYRFWKD
NLQHKDSSVPNTGTARMVETTAYALLTSLNLKDINYVNPIIKWLSEEQRYGGGFYSTQDT
INAIEGLTEYSLLVKQLRLNMDIDVSYKHKGALHNYKMTHKNFLGRPVEVLLNDDLIVST
GFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNSDYKRIVACASYKP
SREESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKDGHVILQLNSIPSS
DFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSASNIKIQKVCEGATCKCVEA
DCGQMQEELDLTISTETRKQTACKPEIAYAYKVSITSITVENVFVKYKATLLDIYKTGEA
VPEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIYPLDSLTWIEYWPR
DTTCSSCQAFLANLDEFAEDIFLNGCQ
Download sequence
Identical sequences ENSGGOP00000002253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]