SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002269 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002269
Domain Number 1 Region: 37-101
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000134
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 144-225
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000258
Family S100 proteins 0.085
Further Details:      
 
Domain Number 3 Region: 231-272
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000272
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002269   Gene: ENSGGOG00000002305   Transcript: ENSGGOT00000002319
Sequence length 314
Comment pep:novel chromosome:gorGor3.1:3:120003704:120019501:-1 gene:ENSGGOG00000002305 transcript:ENSGGOT00000002319 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QWQTWVWVLQIVIVLYNVSIRRKEEELRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQ
CKPHKRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSN
RDELRRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNET
AINITTYPDQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALED
ETYADGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQTEEEMTRYVQELQKHQEAV
DLGYSRKNLSSTSV
Download sequence
Identical sequences ENSGGOP00000002269 ENSGGOP00000002269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]