SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002348 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002348
Domain Number 1 Region: 148-219,266-523
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.92e-95
Family NadC C-terminal domain-like 0.0000153
Further Details:      
 
Domain Number 2 Region: 15-147
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.65e-36
Family NadC N-terminal domain-like 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002348   Gene: ENSGGOG00000002385   Transcript: ENSGGOT00000002399
Sequence length 585
Comment pep:known_by_projection chromosome:gorGor3.1:8:143759799:143763358:-1 gene:ENSGGOG00000002385 transcript:ENSGGOT00000002399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEQDPEARAAARPLLTDLYQATMALGYWRAGRARDAAEFELFFRRCPFGGAFALAAGL
RDCVRFLRAFRLRDADVQFLASVLPPDTDPAFFEHLRALDCSEVTVRALPEGSLAFPGVP
LLQVSGPLLVVQLLETPLLCLVSYASLVATNAARLRLIAGPEKRLLEMGLRRAQGPDGGL
TASTYSYLGGFDSSSNVLAGQLRGVPVAGTLAHSFVTSFSGSEVPPDPMLAPAAGEGPKV
DLAAKAQVWLEHVCAHLGLGVQEPHPGERAAFVAYALAFPRAFQGLLDSYSVWRSGLPNF
LAVALALGELGYRAVGVRLDSGDLLQQAQEIRKAFRAAAAQFQVPWLESVLIVVSNNIDE
EALARLAQEGSEVNVIGIGTSVVTCPQQPSLGGVYKLVAVGGQPRMKLTEDPEKQTLPGS
KAAFRLLGSDGSPLMDMLQLAEEPAPKAGQELKVWPPGAQEPRTVRPAQVEPLLRLCLQQ
GQLCEPLPSLAESRALAQRSLSRLSPEHRRLRSPAQYQVGGRPTLSFCPVRPCPHPAHRS
PPLLPAGGAVREAAGPGEQSVCRAVPLRLGAGLTGNNTNHSVFPT
Download sequence
Identical sequences ENSGGOP00000002348 ENSGGOP00000002348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]