SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002361 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002361
Domain Number 1 Region: 597-802
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-33
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 2 Region: 805-990
Classification Level Classification E-value
Superfamily Fibronectin type III 5.94e-29
Family Fibronectin type III 0.00000167
Further Details:      
 
Domain Number 3 Region: 312-404
Classification Level Classification E-value
Superfamily Immunoglobulin 8.97e-21
Family I set domains 0.0005
Further Details:      
 
Domain Number 4 Region: 410-501
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-19
Family I set domains 0.02
Further Details:      
 
Domain Number 5 Region: 226-312
Classification Level Classification E-value
Superfamily Immunoglobulin 2.37e-18
Family I set domains 0.0031
Further Details:      
 
Domain Number 6 Region: 499-602
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-18
Family I set domains 0.069
Further Details:      
 
Domain Number 7 Region: 23-116
Classification Level Classification E-value
Superfamily Immunoglobulin 6.3e-16
Family I set domains 0.00021
Further Details:      
 
Domain Number 8 Region: 124-207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000141
Family I set domains 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002361   Gene: ENSGGOG00000002395   Transcript: ENSGGOT00000002412
Sequence length 1028
Comment pep:known_by_projection chromosome:gorGor3.1:3:76071864:76334670:-1 gene:ENSGGOG00000002395 transcript:ENSGGOT00000002412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFPWKQLILLSFIGCLGGELLLQGPVFIKEPSNSIFPVGSEDKKITLNCEARGNPSPHY
RWQLNGSDIDMSMEHRYKLNGGNLVVINPNRNWDTGTYQCFATNSLGTIVSREAKLQFAY
LENFKTKMRSTVSVREGQGVVLLCGPPPHSGELSYAWIFNEYPSFVEEDSRRFVSQETGH
LYISKVEPSDVGNYTCVVTSMVTNARVLGSPTPLVLRSDGVMGEYEPKIEVQFPETLPAA
KGSTVKLECFALGNPIPQINWRRSDGLPFSSKIKLRKFSGVLEIPNFQQEDAGSYECIAE
NSRGKNVARGRLTYYAKPHWVQLIKDVEIAVEDSLYWECRASGKPKPSYRWLKNGAALVL
EERTQIENGALTISNLSVTDSGMFQCIAENKHGLVYSSAELKVVASAPDFSKNPMKKLVQ
VQVGSLVSLDCKPRASPRARSSWKKGDVSVQEHERISLLNDGGLKIANVTKADAGIYTCM
AENQFGKANGTTHLVVTEPTRITLAPSNMDVSVGESVILPCQVQHDPLLDIIFTWYFNGA
LADFKKDGSHFEKVGGSSSGDLMIRNIQLKHSGKYVCMVQTGVDSVSSAADLIVRGSPGP
PENVKVDEITDTTAQLSWKEGKDNHSPVISYSIQARTPFSVGWQTVTTVPEVIDGKTHTA
TVVELNPWVEYEFRVVASNKIGGGEPSLPSEKVRTEEAVPEVPPSEVNGGGGSRSELVIT
WDPVPEELQNGEGFGYVVAFRPLGVTTWIQTVVTSPDTPRYVFRNESIVPYSPYEVKVGV
YNNKGEGPFSPVTTVFSAEEEPTVAPSQVSANSLSSSEIEVSWNTIPWKLSNGHLLGYEV
RYWNGSGKEESSSKVKVAGNETSARLRGLKSNLAYYTAVRAYNSAGAGPFSATVNVTTKK
TPPSQPPGNVVWNATDTKVLLNWEQVKAMENESEVTGYKVFYRTSSQNNVQVLNTNKTSA
ELVLPIKEDYIIEVKATTDGGDGTSSEQIRIPRITSMDARGSTSAISNVHPMSSYMPIVL
FLIVYAVW
Download sequence
Identical sequences ENSGGOP00000002361 ENSGGOP00000002361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]