SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002368 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002368
Domain Number 1 Region: 596-802
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-31
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 2 Region: 805-990
Classification Level Classification E-value
Superfamily Fibronectin type III 2.32e-25
Family Fibronectin type III 0.000023
Further Details:      
 
Domain Number 3 Region: 312-404
Classification Level Classification E-value
Superfamily Immunoglobulin 2.74e-20
Family I set domains 0.00085
Further Details:      
 
Domain Number 4 Region: 420-506
Classification Level Classification E-value
Superfamily Immunoglobulin 6.36e-19
Family I set domains 0.029
Further Details:      
 
Domain Number 5 Region: 225-318
Classification Level Classification E-value
Superfamily Immunoglobulin 2.14e-17
Family I set domains 0.0016
Further Details:      
 
Domain Number 6 Region: 502-603
Classification Level Classification E-value
Superfamily Immunoglobulin 3.51e-17
Family I set domains 0.046
Further Details:      
 
Domain Number 7 Region: 123-207
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000627
Family I set domains 0.00042
Further Details:      
 
Domain Number 8 Region: 26-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000225
Family I set domains 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002368   Gene: ENSGGOG00000002403   Transcript: ENSGGOT00000002419
Sequence length 1028
Comment pep:known_by_projection chromosome:gorGor3.1:3:1111643:1442292:1 gene:ENSGGOG00000002403 transcript:ENSGGOT00000002419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLWKLVILLPLINSSAGDGLLSRPIFTQEPHDVIFPLDLSKSEVILNCAANSYPSPHY
RWKQNGTDIDFTMSYHYRLDGGSLAINSPHTDQDIGMYQCLATNLLGTILSRKAKLQFAY
IEDFETKTRSTVSVREGQGVVLLCGPPPHFGDLSYAWTFNDNPLYVQEDNRRFVSQETGN
LYIAKVEPSDVGNYTCFITNKEAQRSVQGPPTPLVQRTDGVMGEYEPKIEVRFPETIQAA
KDSSVKLECFALGNPVPDISWRRLDGSPLPGKVKYSKSQAILEIPNFQQEDEGFYECIAS
NLRGRNLAKGQLIFYAPPEWEQKIQNTYLSIYDNLLWECKASGKPNPWYTWLKNGERLNP
EERIQIENGTLIITMLNVSDSGVYQCAAENKYQIIYANAELRVLASAPDFSKSPVKKKSF
VQVGGDIVIGCKPNAFPRAAISWKRGTETLRQSKRIFLLEDGSLKIYNITRSDAGSYTCI
ATNQFGTAKNTGSLIVKERTVITVPPSKMDVTVGESIVLPCQVSHDPSIEVVFVWFFNGD
VIDLKKGVAHFERIGGESVGDLMIRNIQLHHSGKYLCTVQTTLESLSAVADIIVRGPPGP
PEDVQVEDISSTTSQLSWRAGPDNNSPIQIFTIQTRTPFSVGWQAVATVPEILNGKTYNA
TVVGLSPWVEYEFRVVAGNSIGIGEPSKPSELLRTKASVPVVAPVNIHGGGGSRSELVIT
WESIPEELQNGDGFGYIIMFRPVGSTTWSKEKVSSVESSRFVYRNESIIPLSPFEVKVGV
YNNEGEGSLSTVTIVYSGEDEPQLAPRGTSLQSFSASEMEVSWNAIAWNRNTGRVLGYEV
LYWTDDSKESMIGKIRVSGNVTTKNITGLKANTIYFASVRAYNTAGTGPSSPPVNVTTKK
SPPSQPPANIAWKLTNSKLCLNWEHVKTMENESEVLGYKILYRQNRQSKTHILETNNTSA
ELLVPFEEDYLIEIRTVSDGGDGSSSEEIRIPKMSSLSSRGIQFLEPSTHFLSIVIVIFY
CFAIQPLI
Download sequence
Identical sequences ENSGGOP00000002368

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]