SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002415 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002415
Domain Number 1 Region: 221-297
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 7.33e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002415   Gene: ENSGGOG00000002455   Transcript: ENSGGOT00000002468
Sequence length 582
Comment pep:known_by_projection chromosome:gorGor3.1:17:2373642:2387599:-1 gene:ENSGGOG00000002455 transcript:ENSGGOT00000002468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSIETLLEAARFLEWQAQQQQRAREEQERLRLEREREQEQKKANSLARLAHTLPVEEPRM
EAPPLPLSPPAPPPAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAGQPLPLAPRQ
PALVSTPGLSIKEPAPLPSRPQVPTPAPLLPDSKTTIPPTGSPKPLQPLPTPILTIAPHP
GVQPQLAPQQPPPPTLGTLKLAPAEEVKSSEQKKRPGGIGTREVHNKLEKNRRAHLKECF
ETLKRNIPNVDDKKTSNLSVLRTALRYIQSLKRKEKEYEHEMERLAREKIATQQRLAELK
HELSQWMDVLEIDRVLRQTGQPEDDQASTSTASEGEDNIDEDMEEDRAGLGPPKLSHRPQ
PELLKSTLPPPSTTPAPLPPHPHPHPHSVALSPAHLPVQQQQPQQKTPLPAPPPPPAAPA
QTLVPAPAHLVATAGGGSTVIAHTATTHASVIQTVNHVLQGPGGKHIAHIAPSAPSPAVQ
LAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPAT
VMAKPAVGAQVVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA
Download sequence
Identical sequences ENSGGOP00000002415 ENSGGOP00000002415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]