SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002438 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002438
Domain Number 1 Region: 22-133
Classification Level Classification E-value
Superfamily Immunoglobulin 6.57e-25
Family V set domains (antibody variable domain-like) 0.00012
Further Details:      
 
Domain Number 2 Region: 144-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000302
Family C2 set domains 0.023
Further Details:      
 
Domain Number 3 Region: 256-337
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000134
Family I set domains 0.026
Further Details:      
 
Domain Number 4 Region: 247-314,353-425
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000333
Family I set domains 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002438   Gene: ENSGGOG00000002476   Transcript: ENSGGOT00000002491
Sequence length 500
Comment pep:novel chromosome:gorGor3.1:19:48976079:48980278:-1 gene:ENSGGOG00000002476 transcript:ENSGGOT00000002491 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPLLLLPLLWGGSPQEEPGYELQVQKSVTVQEGLCVLVSCSFSYPWRSWYSSPPLYVYW
FRDGGIPYYAEVVATNNPDRRVKPETQGRFRLLGDVQKKNCSLSIGDARMEDTGSYFFHV
ERGRDVKHSYQQNKLNLEVTALIEKPDIHFLEPLESGRPTRLSCSLPGSCEAGRPLTFSW
TGNALSPLDPETTRSSELTLTPRPEDHGTNLTCQVKRQGAQVTTERTVQLNVSYAPQTIT
IFRNGIALEILQNTSYLPVLEGQALRLLCDAPSNPPAHLSWFQGSPALNATPISNTGILE
LRRVRSAEEGGFTCRAQHPLVFLQIFLNLSVYSLPQLLGPSCSWEAEGLHCSCSFQARPA
PSLCWRLGEKPLEGNSSQGSFKVNSSSAGPWANSSLILHGGLSSDLKVSCKAWNIYGSQS
GSVLLLQGRSNLGTGVVPAALGGAGVMALLCICLCLIFFLIVRARRKQAAGRPEKMDDED
PIMGTVTSHSTKPTPPSSPG
Download sequence
Identical sequences ENSGGOP00000002438 ENSGGOP00000002438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]