SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002443 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002443
Domain Number 1 Region: 148-238
Classification Level Classification E-value
Superfamily Immunoglobulin 1.34e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 2 Region: 33-143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000842
Family V set domains (antibody variable domain-like) 0.025
Further Details:      
 
Domain Number 3 Region: 258-333
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000116
Family I set domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002443   Gene: ENSGGOG00000002483   Transcript: ENSGGOT00000002496
Sequence length 462
Comment pep:known_by_projection chromosome:gorGor3.1:7:90440486:90477516:-1 gene:ENSGGOG00000002483 transcript:ENSGGOT00000002496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQDAFMEPFGDTLGVFQCKIYLLLFGACSGLKVTVPSHTVHGVRGQALYLPVHYGFHTP
ASDIQIIWLFERPHTMPKYLLGSVNKSVVPDLEYQHKFTMMPPNASLLINPLQFPDEGNY
IVKVNIQGNGTLSASQKIQVTVDDPVTKPVVQIHPPSGAVEYVGNMTLTCHVEGGTRLAY
QWLKNGRPVHTSSTYSFSPQNNTLHIAPVTKEDIGNYSCLVRNPVSEMESDIIMPIIYYG
PYGLQVNSDKGLKVGEVFTVDLGEAILFDCSADSHPPNTYSWIRRTDNTTYIIKHGPRLE
VASEKVAQKTMDYVCCAYNNITGRQDETHFTVIITSIGLEKLAQKGKSLSPLASITGISL
FLIISMCLLFLWKKYQPYKVIKQKLEGRPETEYRKAQIFSGHEDALDDFGIYEFVAFPDA
SGVSRIPSRSVPVSDCVSGQDLHSTVYEVIQHIPAQQQDHPE
Download sequence
Identical sequences ENSGGOP00000002443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]