SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002520 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002520
Domain Number 1 Region: 5-402
Classification Level Classification E-value
Superfamily Sema domain 3.27e-47
Family Sema domain 0.0087
Further Details:      
 
Domain Number 2 Region: 999-1128,1302-1451
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.9e-28
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 404-452
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000615
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002520
Domain Number - Region: 614-700
Classification Level Classification E-value
Superfamily E set domains 0.000672
Family E-set domains of sugar-utilizing enzymes 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002520   Gene: ENSGGOG00000002553   Transcript: ENSGGOT00000002573
Sequence length 1518
Comment pep:known_by_projection chromosome:gorGor3.1:12:93209213:93375700:1 gene:ENSGGOG00000002553 transcript:ENSGGOT00000002573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSEQAIGAIAASQEDGVFVASGSCLDQLDYSLEHSLSRLYRDQAGNCTEPVSRSFSKLLL
PYREGAAGLGGLLLTGWTFDRGACEVRPLGNLSRSSLRNGTEVVSCHPQGSTAGVVYRAG
RNNRWYLAVAATYVLPEPETASRCNPAASDHDTAIALKDTEGRSLATQELGRLKLCEGAG
SLHFVDAFLWNGSIYFPYYPYNYTSGAATGWPSMARIAQSTEVLFQGQASLDCGHGHPDG
RRLLLSSSLVEALDVWAGVFSAAAGEGQGRRSPTTTALCLFRMSEIQARAKRVSWDFKTA
ESHCKEGDQPERVQPIASSTLIHSDLTSVYGTVVMNRTVLFLGTGDGQLLKVILGENLTS
NCPEVIYEIKEETPVFYKLVPDPVKNIYIYLTAGKEVRRIRVANCNKHKSCSECLTATDP
HCGWCHSLQRCTFQGDCVHSENLENWLDISSGAKKCPKIQIIRSSREKTTVTMVGSFSPR
HSKCMVKNVDSSRELCQNKSQPNRTCTCSIPTRATYRDVSVVNVMFSFGSWNLSDRFNFT
NCSSLKECPACVETGCAWCKSARRCIHPFTACDPSDYERNQEQCPVAVEKTSGGGRPKEN
KGNRTNQALQVFYIKSIEPQKVSTLGKSNVIVTGANFTRASNITMILKGTSTCDKDVIQV
SHVLNDTHMKFSLPSSRKEMKDVCIQFDGGNCSSVGSLSYIALPHCSLIFPATTWISGGQ
NITMMGRNFDVIDNLIISHELKGNINVSEYCVATYCGFLAPSLKSSKVRTNVTVKLRVQD
TYLDCGTLQYREDPRFTGYRVESEVDTELEVKIQKENDNFNISKKDIEITLFHGENGQLN
CSFENITRNQDLTTILCKIKGIKTASTIANSSKKVRVKLGNLELYVEQESVPSTWYFLIV
LPVLLVIVIFAAVGVTRHKSKELSRKQSQQLELLESELRKEIRDGFAELQMDKLDVVDSF
GTVPFLDYKHFALRTFFPESGGFTHIFTEDMHNRDANDKNESLTALDALICNKSFLVTVI
HTLEKQKNFSVKDRCLFASFLTIALQTKLVYLTSILEVLTRDLMEQCSNMQPKLMLRRTE
SVVEKLLTNWMSVCLSGFLRETVGEPFYLLVTTLNQKINKGPVDVITCKALYTLNEDWLL
WQVPEFSTVALNVVFEKIPENESADVCRNISVNVLDCDTIGQAKEKIFQAFLSKNGSPYG
LQLNEIGLELQVGTRQKELLDIDSSSVILEDGITKLNTIGHYEISNGSTIKVFKKIANFT
SDVEYSDDHCHLILPDSEAFQDVQGKRHRGKHKFKVKEMYLTKLLSTKVAIHSVLEKLFR
SIWSLPNSRAPFAIKYFFDFLDAQAENKKITDPDVVHIWKTNSLPLRFWVNILKNPQFVF
DIKKTPHIDGCLSVIAQAFMDAFSLTEQQLGKEAPTNKLLYAKDIPTYKEEVKSYYKAIR
DLPPLSSSEMEEFLTQESKKHENEFNEEVALTEIYKYIVKYFDEILNKLERERGLEEAQK
QLLHVKVLFDEKKKCKWM
Download sequence
Identical sequences ENSGGOP00000002520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]