SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002732 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002732
Domain Number 1 Region: 134-302
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.22e-28
Family Toll/Interleukin receptor TIR domain 0.0008
Further Details:      
 
Domain Number 2 Region: 2-89
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000014
Family I set domains 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002732   Gene: ENSGGOG00000002775   Transcript: ENSGGOT00000002790
Sequence length 428
Comment pep:known_by_projection chromosome:gorGor3.1:X:103003966:103053684:1 gene:ENSGGOG00000002775 transcript:ENSGGOT00000002790 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPLNIPCKAFFGFSGESGPMIYWMKGEKFIEELAGHIREGEIRLLKEHLGEKEVELALIF
DSVVEADLANYTCHVENRNGRKHASVLLRKKDLIYKIELAGGLGAIFLLLVLLVVIYKCY
NIELMLFYRQHFGADETNDDNKEYDAYLSYTKVDQDTLDCDSPEEEQFALEVLPDVLEKH
YGYKLFIPERDLIPSGTYMEDLTRYVEQSRRLIIVLTPDYILRRGWSIFELESRLHNMLV
SGEIKVILIECTELKGKVNCQEVESLKRSIKLLSLIKWKGPKSSKLNSKFWKHLVYEMPI
KKKEMLPRCHVLDSAEQGLFGELQPIPSIAMTSTSATLMSSQADLPEFHPSDSMQMRHCC
RGYKHEIPATTLPVPSLGNHHTYCNLPLTLLNGQLPLNNTLKDTQEFHRNSSLLPLSSKE
LSFTSDIW
Download sequence
Identical sequences ENSGGOP00000002732 ENSGGOP00000002732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]