SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002765 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002765
Domain Number 1 Region: 521-723
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-38
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 2 Region: 322-514
Classification Level Classification E-value
Superfamily Fibronectin type III 9.33e-37
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 3 Region: 187-293
Classification Level Classification E-value
Superfamily Fibronectin type III 4.13e-25
Family Fibronectin type III 0.00069
Further Details:      
 
Domain Number 4 Region: 1163-1250
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 5 Region: 747-806
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000128
Family V set domains (antibody variable domain-like) 0.087
Further Details:      
 
Domain Number 6 Region: 940-1025
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000749
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 1057-1120
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000846
Family V set domains (antibody variable domain-like) 0.046
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000002765
Domain Number - Region: 839-916
Classification Level Classification E-value
Superfamily Immunoglobulin 0.003
Family I set domains 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002765   Gene: ENSGGOG00000002794   Transcript: ENSGGOT00000002823
Sequence length 1277
Comment pep:known_by_projection chromosome:gorGor3.1:8:1928899:2010104:1 gene:ENSGGOG00000002794 transcript:ENSGGOT00000002823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVTVPFYQKRHRHFDQSYRNIQTRYLLDEYASKKRASTQASSQKSLSQRSSSQRTSSQ
TSLGGTICRLCAKRVSTQEDEEQENRSRYQSLVAAYGETKRQRFLSELAHLEEDVHLARS
QARDKLDKYAIQQMMEDKLAWERHTFEERIRRAPEILVRLRSHTVWERMSVKLCFTVQGF
PTPVVQADPLVTGAPGAPMDLQCHDANRDYVIVTWKPPNTTTESPVMGYFVDRCEVGTNN
WVQCNDAPVKICKYPVTGLFEGRSYIFRVRAVNSAGISRPSRVSDAVAALDPLDLRSLQA
VHLEGEKEMAIYQDDLEGDAQVPGPPTGVHASEISRNYVVLSWEPPIPRGKDPLMYFIEK
SVVGSGSWQRVNAQTAVRSPRYAVFDLMEGKSYVFRVLSANRHGLSEPSEITSPIQAQDV
TVVPSAPGRVLASRNTKTSVVVQWERPKHEEDLLGYYVDCCVAGTNLWEPCNHKPIGYNR
FVVHGLTTGEQYIFRVKAVNAVGMSENSQESDVIKVQAALTVPSHPYGITLLNCDGHSMT
LGWKVPKFSGGSPILGYYLDKREVHHKNWHEVNSSPSKPTILTVDGLTEGSLYEFKIAAV
NLAGIGEPSDPSEHFKCEAWTMPEPGPAYDLTFCEVRDTSLVMLWKAPVYSGSSPVSGYF
VDFREEDAGEWITVNQTTTANRYLKVSDLQQGKTYVFRVRAVNANGVGKPSETSEPVLVE
ARPGTKEISAGVDEQGNIYLGFDCQEMTDASQFTWCKSYEEIADDERFKIETVGDHSKLY
LKNPDKEDLGTYSVSVSDTDGVSSSFVLDPEELERLMALSNEIKNPTIPLKSELAYEIFD
KGRVRFWLQAEHLSPDASYRFIINDREVSDSEIHRIKCDKATGIIEMVMDRFSIENEGTY
TVQIHDGKAKSQSSLVLIGDAFKTVLEEAEFQRKEFLRKQGPHFAEYLHWDVTEECEVRL
VCKVANTKKETVFKWLKDDVLYETEKLPNLERGICELLIPKLSKKDHGEYKATLKDDRGQ
DVSILEIAGKVYDDMILAMSRVCGKSASPLKVLCTPEGIRLQCFMKYFTEEMKVNWCHKD
AKISSSEHMRIGGSEEMAWLQICEPTEKDKGKYTFEIFDGKDNHQRSLDLSGQAFDEAFA
EFQQLKAAAFAEKNRGRLIGGLPDVVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDIQLS
EHFSVKVEQAKYVSMTIKGVTSEDSGKYSINIKNKYGGEKIDVTVSVYKHGEKIPDMAPP
QQAKPKLIPASASAAGQ
Download sequence
Identical sequences G3QK04
ENSGGOP00000002765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]