SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002772 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002772
Domain Number 1 Region: 619-875
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.02e-80
Family Eukaryotic proteases 0.00011
Further Details:      
 
Domain Number 2 Region: 281-383
Classification Level Classification E-value
Superfamily SRCR-like 7.59e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000523
Further Details:      
 
Domain Number 3 Region: 499-600
Classification Level Classification E-value
Superfamily SRCR-like 1.7e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000762
Further Details:      
 
Domain Number 4 Region: 388-488
Classification Level Classification E-value
Superfamily SRCR-like 8.5e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 5 Region: 168-271
Classification Level Classification E-value
Superfamily SRCR-like 8.76e-30
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0012
Further Details:      
 
Domain Number 6 Region: 100-172
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-16
Family Kringle modules 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002772   Gene: ENSGGOG00000002810   Transcript: ENSGGOT00000002830
Sequence length 876
Comment pep:known_by_projection chromosome:gorGor3.1:4:127829378:127903082:-1 gene:ENSGGOG00000002810 transcript:ENSGGOT00000002830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLARFVLALMLGALPEVVGFDSVLNDSLHHSHRHSPPPGPHYSSYYLPTQQRPPRTRPP
PPLPRFPRPPRALPAQRPHALQAGHTPRPHPWGCPAGEPWVSVTDFGARCLRWAEVPPFL
ERSPPASWAQLRGQRHNFCRSPDGAGRPWCFYGDARGKVDWGYCDCRHGSVRLRGGKNEF
EGTVEVYASGVWGTVCSSHWDDSDASVICHQLQLGGKGIAKQTPFSGLGLIPVYWSNVRC
RGDEENILLCEKDIWQGGVCPQKMAAAVTCSFSHGPTFPIIRLAGGSSVHEGRVELYHAG
QWGTVCDDQWDDADAEVICRQLGLSGIAKAWRQAYFGEGSGPVMLDEVRCTGNELSIEQC
PKSSWGEHNCGHKEDAGVSCTPLTDGVIRLAGGKGSHEGRLEVYYRGQWGTVCDDGWTEL
NTYVVCRQLGFKYGKQASANHFEESTGPIWLDDVSCSGKETRFLQCSRRQWGRHDCSHRE
DVSIACYPGGEGHRLSLGFPVRLMDGENKKEGRVEVFINGQWGTICDDGWTDKDAAVICR
QLGYKGPARARTMAYFGEGKGPIHVDNVKCTGNERSLADCIKQDIGRHNCRHSEDAGVIC
DYFGKKASGNSNKESLSSVCGLRLLHRRQKRIIGGKNSLRGGWPWQVSLRLKSYHGDGRL
LCGATLLSSCWVLTAAHCFKRYGNSTRNYAVRVGDYHTLVPEEFEEEIGVQQIVIHREYR
PDSSDYDIALVRLQGPEEQCARFSSHVLPACLPLWRERPQKTASNCYITGWGDTGRAYSR
TLQQAAIPLLPKRFCEERYKGRFTGRMLCAGNLHEHKRVDSCQGDSGGPLMCERPGESWV
VYGVTSWGYGCGVKDSPGVYTKVSAFVPWIKSVTKL
Download sequence
Identical sequences ENSGGOP00000002772 ENSGGOP00000002772

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]