SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002787 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002787
Domain Number 1 Region: 24-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.99e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0042
Further Details:      
 
Domain Number 2 Region: 202-300
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 5.99e-18
Family Glutathione S-transferase (GST), C-terminal domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002787   Gene: ENSGGOG00000002829   Transcript: ENSGGOT00000002848
Sequence length 358
Comment pep:known_by_projection chromosome:gorGor3.1:8:72759075:72775784:1 gene:ENSGGOG00000002829 transcript:ENSGGOT00000002848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERQEEQRGSPPLRAEGKADAEVKLILYHWTHSFSSQKVRLVIAEKALKCEEHDVSLPL
SEHNEPWFMRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPR
VQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPD
LQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLC
GESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNIL
ISAVLPTAFRVAKKRAPKVLGTTLVVGLLAGVGYFAFMLFRKRLGSMILAFRPRPNYF
Download sequence
Identical sequences G3QK24 Q8TB36
9606.ENSP00000220822 ENSGGOP00000002787 ENSP00000220822 ENSGGOP00000002787 ENSP00000220822 NP_061845.2.87134 NP_061845.2.92137 XP_004047211.1.27298 ENSP00000220822 HR6766 gi|108773797|ref|NP_061845.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]