SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002826 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002826
Domain Number 1 Region: 39-282
Classification Level Classification E-value
Superfamily L domain-like 2.38e-45
Family Ngr ectodomain-like 0.0043
Further Details:      
 
Domain Number 2 Region: 1740-1841
Classification Level Classification E-value
Superfamily Immunoglobulin 5.22e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 2139-2234
Classification Level Classification E-value
Superfamily Immunoglobulin 5.78e-19
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 1644-1744
Classification Level Classification E-value
Superfamily Immunoglobulin 9.94e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 5 Region: 2523-2621
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 1840-1935
Classification Level Classification E-value
Superfamily Immunoglobulin 4.56e-18
Family I set domains 0.037
Further Details:      
 
Domain Number 7 Region: 2335-2427
Classification Level Classification E-value
Superfamily Immunoglobulin 9.03e-18
Family I set domains 0.032
Further Details:      
 
Domain Number 8 Region: 583-665
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-16
Family I set domains 0.031
Further Details:      
 
Domain Number 9 Region: 2430-2522
Classification Level Classification E-value
Superfamily Immunoglobulin 3.55e-16
Family I set domains 0.0092
Further Details:      
 
Domain Number 10 Region: 1939-2035
Classification Level Classification E-value
Superfamily Immunoglobulin 5.52e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 2048-2137
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000244
Family I set domains 0.059
Further Details:      
 
Domain Number 12 Region: 2250-2331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000299
Family I set domains 0.038
Further Details:      
 
Domain Number 13 Region: 485-571
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000789
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002826   Gene: ENSGGOG00000002875   Transcript: ENSGGOT00000002890
Sequence length 2622
Comment pep:known_by_projection chromosome:gorGor3.1:3:151979576:152001409:-1 gene:ENSGGOG00000002875 transcript:ENSGGOT00000002890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVKGRGITCLLVSFAVICLVATPGGRACPRRCACYMPTEVHCTFRYLTSIPDSIPPNVE
RINLGYNSLVRLMETDFSGLTKLELLMLHSNGIHTIPDKTFSDLQALQVLKMSYNKVRKL
QKDTFYGLRSLTRLHMDHNNIEFINPEVFYGLNFLRLVHLEGNQLTKLHPDTFVSLSYLQ
IFKISFIKFLYLSDNFLTSLPQEMVSYMPDLDSLYLHGNPWTCDCHLKWLSDWIQEKPDV
IKCKKDRSPSSAQQCPLCMNPRTSKGKPLAMVSAAAFQCAKPTIDSSLKSKSLTILEDSS
SAFISPQGFMAPFGSLTLNMTDQSGNEANMVCSIQKPSRTSPIAFTEENDYIVLNTSFST
FLVCNVDYGHIQPVWQILALYSDSPLILERSHLLSETPQLYYKYKQVAPKPEDIFTNIEA
DLRADPSWLMQDQISLQLNRTATTFSTLQIQYSSDAQITLPRAEIRPVKHKWTMISRDNN
TKLEHTVLVGGTIGLNCPGQGDPTPHLEWLLADGSKVRAPYVSEDGRILIDKSGKLELQM
ADSFDTGVYHCISSNYDDADILTYRITVVEPLVEAYQENGIHHTVFTGETLDLPCHSSGI
PDASISWVIPGNNVLYQSSRDKKVLNNGTLRILQVTPKDQGYYHCVAANPSGVDFLIFQV
SVKMKGQRPLEHDGETEGSGLDESNPIAHLKEPPGAQLRTSALMEAEVGKHTSSTSKRHN
YRELTLQRRGDSTHRRFRENRRHFPPSARRIDPQHWAALLEKAKKNAVPDKRENTTVSPP
PMVTQLPNIPGEEDDSSGTLALHEEFMVLATKASNLPARTVTADSRTISDSPMTNINYGT
EFSPVVNSQILPPEEPTDFKLSTAIKTIAMSKNINPTMSSQIQGTTNQHSSTVFPLLLGA
NEFQDSDQMGRGREHFQSRPPITVRTMIKDVNVKMLSSTTNKLLLESVNTTNSHQTSVRE
VSEPRRNHFYSHTTQILSTSAFPSDPHTAAHSQFPIPRNSTVNIPLFRRFGRQRKIGGRG
RIISPYRTPVLRRHRYSIFRSTTRGSSEKSTTAFSATVLNVTCLSCLPRERLTTATAALS
FPSAAPITFPKADIARVPSEESTTLVQNPLLLLENKPNVEKTTPTIKYFSTEISQVTSTG
AVMTYAPTSIPMEKTHKVNASYPRVSSTNEAKRDSVITLSRSGATTKPPMTIIATTRFSR
RKIPWHQNFVNNHNPKGRLRNQHKVSLQKSTAVMLPKTSPALPRDKVSPFHFTTLSTSVM
QIPSNTLTTAHHTTTKTHNPGSLPTKKELPLPPLNPMLLRIISKDSSTKSISTQTAIPAT
TPTFPVSVIIYETQTERSRAQTIQREQEPQKKNRTDPNISPDQSSGFTTSTAMTPPVLTT
AETSVKPSVSAVTHSPPENTTGISSTISFHSRTLNLTDVIEELAQASTQTLKSTIASETT
LSSKSHQSTTTRKAIIRHSTIPPFLSSSATLMPVPISPPFTQRAVTDNVATPISGLMTNT
VVKLHESSRHNGKPQQLVAEVATSPKVHPNAKFAIGTTHFIYSNLLHSTPMPALTTVKSQ
NSKLTPSPWAENQFWHKPYSEIAEKGKKPEVSMLATTGLSEATTLASDWDGQKNTKKSDF
DKKPVQEATTSKLLPFDSLSRYIFEKPRIVGGKAASFTIPANSDAFLPCEAVGNPLPTIH
WTRVPSGLDLSKRKQNSRVQVLPNGTLSIQRVEIQDRGQYLCSASNLFGTDHLHVTLSVV
SYPPRILERRTKEITVHSGSTVELKCRAEGRPSPTVTWILANQTVVSESSQGSRQAVVMV
DGTLVIHNLSIYDRGFYKCVASNPGGQDSLLVKIQVIAAPPVILEQRRQVIVGTWGESLK
LPCTAKGTPQPSVYWVLSDGTEVKPLQFTNSKLFLFSNGTLYIRNLASSDRGTYECIATS
STGSERRVVMLTMEERVTSPRIESASQKRTEVNFGDKLLLNCSATGEPKPQIMWRLPSKA
VVDQQHRVGSWIHVYPNGSLFIGSVTEKDSGVYLCVARNKMGDDLILMHVSLRLKPAKID
HKQYFRKQVLHGKDFQVDCKASGSPVPEISWSLPDGTMINNAMQADDSGHRTRRYTLFNN
GTLYFNKVGVAEEGDYTCYAQNTLGKDEMKVHLTVITAAPRIRQSNKTNKRIKAGDTAVL
DCEVTGDPKPKIFWLLPSNDMISFSIDRYIFHANGSLTINKVKLLDSGEYVCVARNPSGD
DTKMYKLDVVSKPPLINGLYTNRTVIKATAVRHSKKHFDCRAEGTPSPEVMWIMPDNIFL
TAPYYGSRITVHKNGTLEIRNVRLSDSADFICVARNEGGESVLVVQLEVLEMLRRPTFRN
PFNEKIVAQLGKSTALNCSVDGNPPPEIIWILPNGTRFSNGPQSYQYLIASNGSFIISKT
TREDAGKYRCAARNKVGYIEKLVILEIGQKPVILTYAPGTVKGISGESLSLHCVSDGIPK
PNIKWTMPSGYVVDRPQINGKYILHDNGTLVIKEATAYDRGNYICKAQNSVGHTLITVPV
MIVAYSPRITNRPPRSIVTRTGAAFQLHCVALGVPKPEITWEMPDHSLLSTASKERTHGS
EQLHLQGTLVIQNPQASDSGIYKCTAKNPLGSDYAATYIQVI
Download sequence
Identical sequences ENSGGOP00000002826 ENSGGOP00000002826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]