SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002844 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002844
Domain Number 1 Region: 15-124
Classification Level Classification E-value
Superfamily Immunoglobulin 6.76e-21
Family V set domains (antibody variable domain-like) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002844   Gene: ENSGGOG00000002891   Transcript: ENSGGOT00000002908
Sequence length 243
Comment pep:known_by_projection chromosome:gorGor3.1:1:146950483:146976999:1 gene:ENSGGOG00000002891 transcript:ENSGGOT00000002908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PFSSVTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVS
FFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQ
PGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTS
ESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADI
RKN
Download sequence
Identical sequences Q9UEL4
ENSGGOP00000002844 ENSGGOP00000002844

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]