SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002849 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002849
Domain Number 1 Region: 947-1161
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-103
Family Thrombospondin C-terminal domain 0.00000000419
Further Details:      
 
Domain Number 2 Region: 25-226
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-37
Family Laminin G-like module 0.0000171
Further Details:      
 
Domain Number 3 Region: 762-841
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.09e-17
Family TSP type-3 repeat 0.00037
Further Details:      
 
Domain Number 4 Region: 830-946
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.88e-16
Family TSP type-3 repeat 0.0000326
Further Details:      
 
Domain Number 5 Region: 436-491
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000889
Family TSP-1 type 1 repeat 0.0000813
Further Details:      
 
Domain Number 6 Region: 318-376
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000000921
Family VWC domain 0.0047
Further Details:      
 
Domain Number 7 Region: 689-773
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.000000000000144
Family TSP type-3 repeat 0.00013
Further Details:      
 
Domain Number 8 Region: 382-430
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000523
Family TSP-1 type 1 repeat 0.00095
Further Details:      
 
Domain Number 9 Region: 546-598
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000354
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002849   Gene: ENSGGOG00000002892   Transcript: ENSGGOT00000002913
Sequence length 1162
Comment pep:known_by_projection chromosome:gorGor3.1:6:170379894:170415167:-1 gene:ENSGGOG00000002892 transcript:ENSGGOT00000002913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMQQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPKGGAWAVVWSECIICISFGVRGQLCGLEHGTPQGGLASVLRRARGELC
SAFSHPDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDICFST
SKVPRCVNTQPGFHCLPCPPRYRGSEPVGVGLEAAKTEKQVCEPENPCKDKTHNCHKHAE
CIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNCPHLP
NSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCPYVHN
PAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLVHNP
DQVRAAAGRRGWGSSSEGRRDGGSVGDHYDNCPWCTTLTRFAFERDKGGQTDVDNDLVGD
QCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFRNFQMVPLDPK
GTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDRDDDYAGFVFG
YQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRNALWHTGNTPG
QVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPIYDQTYAGGRL
GLFVFSQEMVYFSDLKYECRDI
Download sequence
Identical sequences ENSGGOP00000002849 ENSGGOP00000002849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]