SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002881 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002881
Domain Number 1 Region: 110-216
Classification Level Classification E-value
Superfamily Fibronectin type III 3.84e-19
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 214-309
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000041
Family Fibronectin type III 0.00015
Further Details:      
 
Domain Number 3 Region: 32-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000258
Family I set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002881   Gene: ENSGGOG00000002931   Transcript: ENSGGOT00000002946
Sequence length 422
Comment pep:known_by_projection chromosome:gorGor3.1:9:35339287:35347546:1 gene:ENSGGOG00000002931 transcript:ENSGGOT00000002946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSCSGLSRVLVAVATALVSASSPCPQAWGPPGVQYGQPGRSVKLCCPGVTAGDPVSWF
RDGEPKLLQGPDSGLGHELVLAQADSTDEGTYICRTLDGALGGTVTLQLGYPPARPVVSC
QAADYENFSCTWSPSQISGLPTRYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARC
VVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYPRRLRASW
TYPASWPRQPHFLLKFRLQYRPAQHPAWSTVEPAGLEEVITDAVAGLPHAVRVSARDFLD
AGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRSSLQPHPRLLDHR
DSVEQVAVLASLGILSFLGLVAGALALGLWLRLRRGGKDGSPKPGFLASVIPVDRRPGAP
NL
Download sequence
Identical sequences ENSGGOP00000002881 ENSGGOP00000002881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]