SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000002975 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000002975
Domain Number 1 Region: 431-636
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-64
Family Kelch motif 0.00000623
Further Details:      
 
Domain Number 2 Region: 328-473
Classification Level Classification E-value
Superfamily Kelch motif 6.8e-35
Family Kelch motif 0.0003
Further Details:      
 
Domain Number 3 Region: 9-127
Classification Level Classification E-value
Superfamily POZ domain 2.08e-28
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000002975   Gene: ENSGGOG00000003025   Transcript: ENSGGOT00000003041
Sequence length 642
Comment pep:known_by_projection chromosome:gorGor3.1:1:164923549:164944375:-1 gene:ENSGGOG00000003025 transcript:ENSGGOT00000003041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPNGYLMFEDENFIESSVAKLNALRKSGQFCDVRLQVCGHEMLAHRAVLACCSPYLFEI
FNSDSDPHGISHVKFDDLNPEAVEVLLNYAYTAQLKADKELVKDVYSAAKKLKMDRVKQV
CGDYLLSRMDVTSCISYRNFASCMGDSRLLNKVDAYIQEHLLQISEEEEFLKLPRLKLEV
MLEDNVCLPSNGKLYTKVINWVQRSIWENGDSLEELMEEVQTLYYSADHKLLDGNLLDGQ
AEVFGSDDDHIQFVQKKPPRENGHKQISSSSTGCLSSPNATVQSPKHEWKIVASEKTSNN
TYLCLAVLDGIFCVIFLHGRNSPQSSPTSTPKLSKSLSFEMQQDELIEKPMSPMQYARSG
LGTAEMNGKLIAAGGYNREECLRTVECYNPHTDHWSFLAPMRTPRARFQMAVLMGQLYVV
GGSNGHSDDLSCGEMYDSNIDDWIPVPELRTNRCNAGVCALNGKLYIVGGSDPYGQKGLK
NCDVFDPVTKLWTSCAALNIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWT
LIAPMNVARRGAGVAVLNGKLFVCGGFDGSHAISCVEMYDPTRNEWKMMGNMTSPRSNAG
IATVGNTIYAVGGFDGNEFLNTVEVYNLESNEWSPYTKIFQF
Download sequence
Identical sequences G3QKK0
ENSGGOP00000002975 XP_004028099.1.27298 ENSGGOP00000002975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]