SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003033 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003033
Domain Number 1 Region: 26-500
Classification Level Classification E-value
Superfamily Sema domain 7.85e-171
Family Sema domain 0.0000000000000119
Further Details:      
 
Domain Number 2 Region: 502-552
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000109
Family Plexin repeat 0.0000445
Further Details:      
 
Domain Number 3 Region: 563-650
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000452
Family I set domains 0.0000292
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003033   Gene: ENSGGOG00000003083   Transcript: ENSGGOT00000003101
Sequence length 862
Comment pep:known_by_projection chromosome:gorGor3.1:9:71301414:71378036:-1 gene:ENSGGOG00000003083 transcript:ENSGGOT00000003101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMCNPIRGLLMALAVMFGTAMAFAPIPRITWEHREVRLVQFHEPDIYNYSALLLSEDKD
TLYIGAREAVFAVNALNISEKQHEVYWKVSEDKKAKCAEKGKSKQTECLNYIRVLQPLSA
TSLYVCGTNAFQPACDHLNLTSFKFLGKNEDGKGRCPFDPAHSYTSVMVDGELYSGTSYN
FLGSEPIISRNSSHSPLRTEYAIPWLNEPSFVFADVIRKSPDSPDGEDDRVYFFFTEVSV
EYEFVFRVLIPRIARVCKGDQGGLRTLQKKWTSFLKARLICSRPDSGLVFNVLRDVFVLR
SPGLKVPVFYALFTPQLNNVGLSAVCAYNLSTAEEVFSHGKYMQSTTVEQSHTKWVRYNG
PVPKPRPGACIDSEARAANYTSSLNLPDKTLQFVKDHPLMDDSVTPIDNRPRLIKKDVNY
TQIVVDQTQALDGTVYDVMFVSTDRGALHKAISLEHAVHIIEETQLFQDFEPVQTLLLSS
KKGSRFVYAGSNSGVVQAPLAFCGKHGTCEDCVLARDPYCAWSPSTATCVALHQTESPSR
GLIQEMSGDASVCPDKSKGSYRQHFFKHGGTAELKCSQKSNLARVFWKFQNGVLKAESPK
YGLMGRKNLLIFNLSEGDSGVYQCLSEERVKNKTVFQVVAKHVLEVKVVPKPVVAPTLSI
VQTEGSRIATKVLVASTQGSSPPTPAVQATSSGAITLPPKPAPTGTSCEPKIVINTVPQL
HSEKTMYLKSSDNRLLMSLFLFFFVLFLCLFFYNCYKGYLPRQCLKFRSALLIGKKKPKS
DFCDREQSLKETLVEPGSFSQQNGEHPKPALDTGYETEQDTITSKVPTDREDSQRIDDLS
ARDKPFDVKCELKFADSDADGD
Download sequence
Identical sequences ENSGGOP00000003033 ENSGGOP00000003033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]