SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003045 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003045
Domain Number 1 Region: 1064-1360
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.25e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000218
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003045
Domain Number - Region: 542-708
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0199
Family BAR domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003045   Gene: ENSGGOG00000003089   Transcript: ENSGGOT00000003113
Sequence length 1538
Comment pep:known_by_projection chromosome:gorGor3.1:3:48610652:48643036:1 gene:ENSGGOG00000003089 transcript:ENSGGOT00000003113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
TMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
VPMAAHEASSLYSEEKAKLLREMMAKIEDKNEVLDQGCLCWERNEMSIPNRFPNAAFPPR
VVGLVNALGMFCETRPDLVVGVRGPSGSFDTVRVGSAPSTHLAVLLPTASSWAVGQAGAI
SVPSKAELAEVRREWAKYMEVHEKASFTNSELHRAMNLHVGNLRLLSGPLDQVRAALPTP
ALSPEDKAVLQNLKRILAKVQEMRDQRVSLEQQLRELIQKDDITASLVTTDHSEMKKLFE
EQLKKYDQLKVYLEQNLAAQDRVLRALTEANVQYAAVRRVLSDLDQKWNSTLQTLVASYE
AYEDLMKKSQEGRDFYADLESKVAALLERTQSTCQAREAARQQLLDRELKKKPPPRPTAP
KPLLPRREESEAVEAGDPPEELRSLPPDMVAGPRLPDTFLGTATPLHFPPSPFPSSTGPG
PHYLSGPLPPGTYSGPTQLIQPRAPGPPAMPVAPGPAVYPAPAYTPELGLVPRSSPQHGV
VSSPYVGVGPAPPVAGLPSAPPPQFSGPELAMAVRPATTTVDSIQAPIPSHTAPRPNPTP
APPPPCFPVPPPQPLPTPYTYPAGAKQPIPAQHHFSPFPSPGPPQPPHPPLAYGPAPSTR
PMGPQAAPLTIRGPSSAGQSTPSPHLVPSPAPSPGPGPVPPRPPAAEPPPCLRRGAAAAD
LLSSSPESQHGGTQPPGGGQPLLQPTKVDAAEGRRPQALRLIERDPYEHPERLRQLQQEL
EAFRGQLGDVGALDTVWRELQDAQEHDARGRSIAIARCYSLKNRHQDVMPYDSNRVVLRS
GKDDYINASCVEGLSPYCPPLVATQAPLPGTAADFWLMVHEQKVSVIVMLVSEAEMEKQK
VARYFPTERGQPMVHGALSLALSSVRSTETHVERVLSLQFRDQSLKRSLVHLHFPTWPEL
GLPDSPSNLLRFIQEVHAHYLHQRPLHTPIIVHCSSGVGRTGAFALLYAAVQEVEAGNGI
PELPQLVRRMRQQRKHMLQEKLHLRFCYEAVVRHVEQVLQRHGVPPPCKPLASASISQKN
HLPQDSQDLVLGGDVPISSIQATIAKLSIRPPGGLESPVASLPGPAEPPGLPPASLPEST
PIPSSSPPPLSSPLPEAPQPKEEPPVPEAPSSGPPSSSLELLASLTPEAFSLDSSLRGKQ
RMSKHNFLQAHNGQGLRATRPSDDPLSLLDPLWTLNKT
Download sequence
Identical sequences ENSGGOP00000003045 ENSGGOP00000003045

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]