SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003079 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003079
Domain Number 1 Region: 88-167
Classification Level Classification E-value
Superfamily Ribosome-binding factor A, RbfA 0.000000000000196
Family Ribosome-binding factor A, RbfA 0.00000829
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003079
Domain Number - Region: 240-297
Classification Level Classification E-value
Superfamily eIF-2-alpha, C-terminal domain 0.0759
Family eIF-2-alpha, C-terminal domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003079   Gene: ENSGGOG00000003131   Transcript: ENSGGOT00000003147
Sequence length 314
Comment pep:known_by_projection chromosome:gorGor3.1:18:78561060:78572098:1 gene:ENSGGOG00000003131 transcript:ENSGGOT00000003147 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAAAGGLWRSRAGLRALFPSRDAALFPGCERGLHCSAVSCKNWLKKFASKTKKKVWYES
PSLGSHSTYKPSKLEFLMRSTSKKTRKEDHARLRALNGLLYKALTDLLCTPEVSQELYDL
NVELSKVSLTPDFSACRAYWKTTLSAEQNAHMEAVLQRSAAHMLDQLLAVADFGPRDERD
NFVRNDFRDPDAPQPCGITEPATSSSLCGIDHEALNKQIMEYKRRKDKGLRGLVWQGQVA
ELTTQMKKGRKRAKPRLEQDSSLKSYLSGEEVEDDLDLVGAPEYECYAPDTEELEAERGG
GRTEDGHSCGATRE
Download sequence
Identical sequences ENSGGOP00000003079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]