SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003129 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003129
Domain Number 1 Region: 604-765
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.03e-29
Family Growth factor receptor domain 0.00067
Further Details:      
 
Domain Number 2 Region: 508-664
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.07e-28
Family Growth factor receptor domain 0.00054
Further Details:      
 
Domain Number 3 Region: 899-1056
Classification Level Classification E-value
Superfamily Growth factor receptor domain 9.82e-27
Family Growth factor receptor domain 0.00075
Further Details:      
 
Domain Number 4 Region: 3038-3182
Classification Level Classification E-value
Superfamily CalX-like 4.84e-25
Family CalX-beta domain 0.0012
Further Details:      
 
Domain Number 5 Region: 2552-2673
Classification Level Classification E-value
Superfamily CalX-like 5.62e-25
Family CalX-beta domain 0.00084
Further Details:      
 
Domain Number 6 Region: 2917-3039
Classification Level Classification E-value
Superfamily CalX-like 1.07e-23
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 7 Region: 2798-2913
Classification Level Classification E-value
Superfamily CalX-like 1.14e-19
Family CalX-beta domain 0.002
Further Details:      
 
Domain Number 8 Region: 421-524
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.57e-18
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 9 Region: 2673-2798
Classification Level Classification E-value
Superfamily CalX-like 8.5e-18
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 10 Region: 761-878
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-17
Family Growth factor receptor domain 0.00071
Further Details:      
 
Domain Number 11 Region: 81-154
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000303
Family VWC domain 0.0096
Further Details:      
 
Domain Number 12 Region: 210-280
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000126
Family VWC domain 0.019
Further Details:      
 
Domain Number 13 Region: 152-217
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000167
Family VWC domain 0.024
Further Details:      
 
Domain Number 14 Region: 272-344
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000596
Family VWC domain 0.011
Further Details:      
 
Domain Number 15 Region: 26-88
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000701
Family VWC domain 0.004
Further Details:      
 
Domain Number 16 Region: 368-421
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000889
Family VWC domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003129
Domain Number - Region: 1047-1096
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0345
Family Growth factor receptor domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003129   Gene: ENSGGOG00000003170   Transcript: ENSGGOT00000003200
Sequence length 4012
Comment pep:known_by_projection chromosome:gorGor3.1:4:86781087:87287963:1 gene:ENSGGOG00000003170 transcript:ENSGGOT00000003200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVLKVWLGLALALAEFAVLPHHSEGACVYQGSLLADATIWKPDSCQSCRCHGDIVICKP
AVCRNPQCAFEKGEVLQIAANQCCPECVLRTPGSCHHEKKIHEHGTEWASSPCSVCSCNH
GEVRCTPQPCPPLSCGHQELAFIPEGSCCPVCVGPGKPCSYEGHVFQDGEDWRLSRCAKC
LCRNGVVQCFTAQCQPLFCNQDETVVRVPGKCCPQCSARSCSAAGQVYEHGEQWSENACT
TCICDRGEVRCHKQACLPLRCGKGQSRARRHGQCCEECVSPAGSCSYDGVVRYQDEMWKG
LACEFCMCDHGQVTCQTGECAKVECAWGEELIHLDGKCCPECISRNGYCVYEETGEFMSS
NASEVKRIPEGEKWEDGPCKVCECRGAQVTCYEPSCPPCPVGTLALEVKGQCCPDCTSVH
CHPDCLTCSQSPDHCDLCQDPTKLLQNGRCVHSCGLGFYQAGSLCLACQPQCSTCTSGLE
CSSCQPPLLMRHGQCVSTCGDGFYQDRHSCAVCHESCAGCWGPTEKHCLACRDPLHVLRD
GGCESSCGKGFYNRQGTCSACDQSCDSCGPSSPRCLTCTEKTVLHDGKCMSECPGGYYAD
ATGRCKVCHNSCASCSGPTASHCTACSPPKALRQGHCLPRCGEGFYSDHGVCKACHSSCL
ACMGPAPSHCTGCKKPEEGLQVEQLSGAGIPSGECLAQCRAHFYLESTGICEACHQSCFR
CAGKSPHNCTDCGPSHVLLDGQCLSQCPDGYFHQEGSCTECHPTCRQCHGPLESDCVSCY
PHISLTNGNCRTSCREAQFLNLVGYCADCHHLCQHCAADLHNTGSICLRCQNAHYLLLGD
HCVPDCPSGYYAERGACKKCHSSCRTCQGRGPFSCSSCDTNLVLSHTGTCSTTCFPGHYL
DDNHVCQPCNTHCGSCDSQASCTSCRDPNKVLLFGECQYESCAPQYYLDFSTNTCKECDW
SCSACSGPLKTDCLQCMDGYALQDGACVEQCLSSFYQDSGLCKNCDSYCLQCQGPHECTR
CKGPFLLLEAQCVQECGKGYFADHAKHKCTACPRGCLQCSHRDRCHLCDHGFFLKSGLCV
YNCVPGFSVHTSNETCSGKIHTSSLHVNGSLILPIGSIKPLDFSLLNVQDQEGRVEDLLF
HVVSTPTNGQLVLSRNGKEVQLDKAGHFSWKDVNEKKVRFVHSKEKLRKGYFFLKISDQQ
FFSEPQLINIQAFSTQAPYVLRNEVLHISRGERATITTQLLDIRDDDNPQDVVIEIIDPP
LHGQLLQTLQSPAAPIYQFQLDELSRGLLHYAHDGSDSTSDVAVLQANDGHSFHNILFQV
KTVPQNDRGLQLVANSMVWVPEGGMLQITNRILQAEAPGANAEEIIYKITQDYPQFGEVV
LLVNMPADSPADEGQHLPDGRTATPTSSFTQQDINEGIVWYRHSGAPAQSDSFRFEVSSA
SDAQTRLESHMFNIAILPQTPETPKVSLEASLHMTAREDGLTVIQPHSLSFINSEKPSGK
IVYNITLPLHPNQGIIEHRDHPQSPIRYFTQEDINQGKVMYRPPPAAPHLQELMAFSFAG
LPESVKFHFTVSDGEHTSPEMVLTIHLLHSDQQLPVFQVTAPRLAVSPGGSTSVGLQVVV
RDAETAPKELFFELRRPPQHGVLKKHTAEFRRPMATGDTFTYEDVEKNALQYIHDGSSTR
EDSMEISVTDGLTVTMLEVRVEVSLSEDRGPRLAAGSSLSITVASKSTAVITRSHLAYVD
DSSPDPEIWIQLNYLPSYGTLLRTSGSEVEELSEVSNFTMEDINNKKIRYSAVFETDGHL
VTDSFYFSVSDMDHNHLDNQIFTIMITPAENPPPVIAFADLITVDEGGRAPLSFHHFFAT
DDDDNLQGDAIIKLSALPKYGCIENTGTGDRFGPETTSDLEASFPIQDVLENYIYYFQSV
HESIEPTHDIFSFYVSDGTSRSEIHSINITIERKNDEPPRMTLQPLRVQLSSGVVISNAS
LSLQDLDTPDNELIFVLTKKPDHGHVLWRQTASEPLENGRVLAQGSTFTYQDILAGLVWY
VPSVPGMVVDEFQFSLTDGLHVDTGRMKIYTELPASDTPHLAINQGLQLSAGSVARITEQ
HLKVTDIDSDDHQVMYLMKEDPGAGRLQMMKHGNLEQISIKGPIRSFTQADISQGHVEYS
HGTGEPGGSFAFKFDVVDGEGNRLIDKSFSISVLEDKSPPVIITNKGLVLDENSVKKITT
LQLSATDQDSGPTELIYRITRQPQLGHLEHATSPGIQISSFTQADLTSRNVQYVHSSEAE
KRSDAFSFTLSDGVNEVTQTFHITLHPVDDSLPVVQNLGMRVQEGVRKTITEFELKAVDA
DTEAESVTFTIVQPPRHGTIERTSNGQHFHLTSIFTMEDIYQNRVSYSHDGSNSLKDRFT
FTVSDGTNPFFIIEEGGKEIMTAAPQPFRVDILPVDDGTPRIVTNLGLQWLEYMDGKATN
LITKKELLTMDPDTEDAQLVYEITTGPKHGFVENKLQPGRAAATFTQEDVNLGLIRYVLH
KEKIREMMDSFHFLVKDSKPNVVSDNVFHIQWSLISFKYTSYNVSEKAGSVSVTVQRTGN
LNQYAIVLCRTEQGTASSSSRVSSQPGQQDYVEYAGQVQFDEREDTKSCTIVINDDDVFE
NVESFTVELSMPAYALLGEFTQAKVIINDTEDEPTLEFDKKIYRVNESAGFLFAPIERKG
DASSIVSAICYTVPKSAMGSSLYALESGSDFKSRGMSAASRVIFGPGVTMSTCDVMLIDD
SEYEEEEEFEIALADASDNARIGRVATAKVLISGPNDASTVSLGNTAFTVSEDAGTVKIP
VIRHGTDLSTFTSVWCATRPSDPASATPGVDYVPSSRKVEFGPGVIEQYCTLTILDDTQY
PVIEGLETFVVFLSSAQGAELTKPFQAVIAINDTFQDVPSMQFAKDLLLVKEKEGVLHVP
ITRSGDLSYESSVRCYTQSHSAQVMEDFEERRNADSSRITFLKGDKVKNCTVYIHDDSMF
EPEEQFRVYLGLPLGNHWSGARIGKNNMATITISNDEDAPTIEFEEAAYQVREPAGPDAI
AILNIKVIRRGDQNRTSKVRCSTRDGSAQSGVDYYPKSRVLKFSPGVDHIFFKVEILSNE
DREWHESFSLVLGPDDPVEAVLGDVTTATVTILDQEAAGSLILPAPPIVVTLADYDHVEE
VTKEGVKKSPSPGYPLVCVTPCDPHFPRYAVMKERCSEAGINQTSVQFSWEVAAPTDGNG
ARSPFETITDNTPFTSVNHMVLDSIYFSRRFHVRCVAKAVDKVGHVGTPLRSNIVTIGTD
SAICHTPVVAGTSRGFQAQSFIATLKYLDVKHKEHPNRIHISVQIPHQDGMLPLISTMPL
HNLHFLLSESIYRHQHVCSNLVTTYDLRGISEAGFLDDVVYDSTALGPGYDRPFQFDPSV
REPKTIQLYKHLNLKSCVWTFDAYYDMTELIDVCGGSVTADFQVRDSAQSFLTVHVPLYV
SYIYVTAPRGWASLEHHTEMEFSFFYDTVLWRTGIQTDSVLSARLQIIRIYIREDGRLVI
EFKTHAKFRGQFVMEHHTLPDVKSFILTPDHLGGIEFDLQLLWSAQTFDSPHQLWRATSS
YNRKDYSGEYTIYLIPCTVQPTQPWVGPGEKPLACTAHAPERFLIPIAFQQTNRPVPVVY
SLNTEFQLCNNEKVFLMDPNTSDMSLAEMDYKGAFSKGQILYGRVLWNPEQNLNSAYKLQ
LEKVYLCTGKDGYVPFFDPTGTIYNEGPQYGCIQPNKHLKHRFLLLDRNQPEVTDKYFHD
VPFEAHFASELPDFHVVSNMPGVDGFTLKVDALYKVEAGHQWYLQVIYIIGPDTISGPRV
QRSLTAPLRRNRRDLVEPNGQLILDDSLIYDNEGDQVKNGTNMKSLNLEMQELAVAASLS
QTGASIGSALAAIMLLLLVFLVACFINRKCQKQRKKKPAEDILEEYPLNTKVEVPKRHLD
RVEKNVNRQYCTVRNVNILSEPEAAYTFKGAKVKRLNLEVRVHNNLQDGTEV
Download sequence
Identical sequences ENSGGOP00000003129 ENSGGOP00000003129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]