SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003135 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003135
Domain Number 1 Region: 512-773
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.62e-91
Family Eukaryotic proteases 0.00000000342
Further Details:      
 
Domain Number 2 Region: 258-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-29
Family Spermadhesin, CUB domain 0.00085
Further Details:      
 
Domain Number 3 Region: 87-170
Classification Level Classification E-value
Superfamily SEA domain 0.00000000000471
Family SEA domain 0.01
Further Details:      
 
Domain Number 4 Region: 444-481
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 372-407
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 407-444
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000916
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 483-523
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000139
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003135
Domain Number - Region: 209-251
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00055
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003135   Gene: ENSGGOG00000003188   Transcript: ENSGGOT00000003206
Sequence length 774
Comment pep:known_by_projection chromosome:gorGor3.1:11:128461989:128518072:1 gene:ENSGGOG00000003188 transcript:ENSGGOT00000003206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSDRAHKGGGGPKDFGAGLKYNSRHEKVNGLEEDVEFLPVNNVKKVEKHGPGRWVVLAA
VLIGLLLVLLGVGFLVWHLQYRDVRVQKVFNGYMRITNENFVDAYENSNSTEFVSLASKV
KDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVEEAERVMAEERVVM
LPPRARSLKSFVVTSVVAFPTDSKTVHRTQDLCGTYPPSYNLTFHSSQNVLLITLITNTE
RRHPGFEATFFQLPKMSSCGGRLRKAQGTFNSPYYPGHYPPNIDCTWNIEVPNNQHVKVR
FKFFYLLEPGVPAGTCPKDYVEINGEKYCGERSQFVVTSNSNKITVRFHSDQSYTDTGFL
AEYLSYDSSDPCPGQFTCRTGRCIRKELRCDGWADCTDHSDELNCSCDASHQFTCKNKFC
KPLFWVCDSVNDCGDNSDEQGCSCPAQTFRCSNGKCLSKSQQCNGKDDCGDGSDEASCPK
VNVITCTKHTYRCLNGLCLSKGNPECDGKEDCSDGSDEKDCDCGLRSFTRQARVVGGTDA
DEGEWPWQVSLHALGQGHICGASLISPNWLVSAAHCYIDDRGFRYSDPTQWTAFLGLHDQ
SQRSAPGVQERRLKRIISHPLFNDFTFDYDIALLELEKPAEYSSMVRPICLPDASHVFPA
GKAIWVTGWGHTQYGGTGALILQKGEIRVINQTTCENLLPQQITPRMMCVGFLSGGVDSC
QGDSGGPLSSVEADGRIFQAGVVSWGDGCAQRNKPGVYTRLPLFRDWIKENTGV
Download sequence
Identical sequences ENSGGOP00000003135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]