SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003173 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003173
Domain Number 1 Region: 204-316
Classification Level Classification E-value
Superfamily Immunoglobulin 1.1e-44
Family V set domains (antibody variable domain-like) 0.0000012
Further Details:      
 
Domain Number 2 Region: 315-386
Classification Level Classification E-value
Superfamily Immunoglobulin 5.38e-27
Family C2 set domains 0.0000287
Further Details:      
 
Domain Number 3 Region: 28-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000186
Family V set domains (antibody variable domain-like) 0.000014
Further Details:      
 
Domain Number 4 Region: 127-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000154
Family C2 set domains 0.0000288
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003173   Gene: ENSGGOG00000003230   Transcript: ENSGGOT00000003246
Sequence length 458
Comment pep:known_by_projection chromosome:gorGor3.1:12:6986144:7125684:1 gene:ENSGGOG00000003230 transcript:ENSGGOT00000003246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRGVPFRHLLLVLQLALLPAATQGNKVVLGKKGDTVELNCTASQKKSIQFRWKNSNQMK
ILGNQGSFLTKGPSKLSDRADSRRSLWDQGNFPLIIKNLKIEDSDTYICEVEGQKEEVQL
LVFGLTANSDTHLLQGQSLTLTLESPPGSSPSVQCRSPRGKNIQGGRTLSVSQLELQDSG
TWTCTVLQNQEKVEFKIDIVVLAFQKASSIVYKKEGEQVEFSFPLAFTVEKLTGSGELWW
QAERASSSKSWITFDLKNKEVSVKRVTQDPKLQMGKKLPLHLTLPQALPQYAGSGNLTLA
LEAKTGKLHQEVNLVVMRATQLRENLTCEVWGPTSPKLMLSLKLENKEAKVSKQEKAVWV
LNPEAGMWQCLLSDSGQVLLESNIKVLPTWSTPVQPMALIVLGGVAGLLLFIGLGIFFCV
RCRHRRRQAERMSQIKRLLSEKKTCQCPHRFQKTCSPI
Download sequence
Identical sequences G3QL31
ENSGGOP00000003173 XP_004052630.1.27298 ENSGGOP00000003173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]