SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003212 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003212
Domain Number 1 Region: 309-366
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.33e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 2-41
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000497
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003212
Domain Number - Region: 269-314
Classification Level Classification E-value
Superfamily ARM repeat 0.00564
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003212   Gene: ENSGGOG00000003265   Transcript: ENSGGOT00000003285
Sequence length 366
Comment pep:known_by_projection chromosome:gorGor3.1:14:62620617:62661824:-1 gene:ENSGGOG00000003265 transcript:ENSGGOT00000003285 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFHSEEQQLLLQV
QQQHQPQQQQHHHHHHHQQAQPQQTVPQQAQTQQVLIPASQQATAPQVIVPDSKLIQHMN
ASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQPQQSVVLQQQVIP
QMQPGGVQAPVIQQVLAPLPGGISPQTGVIIQPQQILFTGNKTQVIPTTVAAPTPAQAQI
TATGQQQPQAQPAQTQAPLVLQVDGTGDTSSEEDEDEEEDYDDDEEEDKEKDGAEDGQVE
EEPLNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKA
IGDAEW
Download sequence
Identical sequences A0A2I2YRW2 A0A2K5Y8J5
ENSGGOP00000003212 ENSGGOP00000003212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]