SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003288 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003288
Domain Number 1 Region: 380-543
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 9.42e-24
Family Toll/Interleukin receptor TIR domain 0.0018
Further Details:      
 
Domain Number 2 Region: 225-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000107
Family I set domains 0.00000221
Further Details:      
 
Domain Number 3 Region: 137-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000134
Family I set domains 0.0000137
Further Details:      
 
Domain Number 4 Region: 44-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000196
Family I set domains 0.0000363
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003288   Gene: ENSGGOG00000003344   Transcript: ENSGGOT00000003362
Sequence length 569
Comment pep:known_by_projection chromosome:gorGor3.1:2a:99659010:99685232:1 gene:ENSGGOG00000003344 transcript:ENSGGOT00000003362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLLRLICFIALLISSLEADKCKEREEKIILVSSANEIDVRPCPLNPNEHKGNITWYKD
DSKTPVSTEQASRIHQHKEKLWFVPAKVEDSGHYYCVVRNSSYCLRIKITAKFVENEPNL
CYNAQAIFKQKLPVAGDGGLVCPYMEFFKNENNELPKLQWYKDCKPLLLDNIHFSGVKDR
LIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETMEVDL
GSQIQLICNVTGQLSDIAYWKWNGSVIDEDDPVLGEDYYSVENPANKRRSTLITVLNISE
IESRFYKHPFTCFAKNTHGIDAAYIQLIYPVTNFQKHMIGICVTLTVIIVCSVFIYKIFK
IDIVLWYRDSCYDFLPIKASDGKTYDAYILYPKTVGEGSTSDCDIFVFKVLPEVLEKQCG
YKLFIYGRDDYVGEDIVEVINENVKKSRRLIIILVRETSGFSWLGGSSEEQIAMYNALVQ
DGIKVVLLELEKIQDYEKMPESIKFIKQKHGAIRWSGDFTQGPQSAKTRFWKNVRYHMPV
QRRSPSSKHQLLSPAAKEKLQREAHVPLG
Download sequence
Identical sequences G3QLD8
XP_004031573.1.27298 XP_018876915.1.27298 XP_018876916.1.27298 XP_018876917.1.27298 XP_018876918.1.27298 XP_018876919.1.27298 ENSGGOP00000003288 ENSGGOP00000003288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]