SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003293 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003293
Domain Number 1 Region: 373-537
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 6.41e-23
Family Toll/Interleukin receptor TIR domain 0.005
Further Details:      
 
Domain Number 2 Region: 27-114
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000774
Family I set domains 0.0079
Further Details:      
 
Domain Number 3 Region: 134-203
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000107
Family I set domains 0.018
Further Details:      
 
Domain Number 4 Region: 229-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000109
Family I set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003293   Gene: ENSGGOG00000003351   Transcript: ENSGGOT00000003368
Sequence length 575
Comment pep:known_by_projection chromosome:gorGor3.1:2a:99692475:99745537:1 gene:ENSGGOG00000003351 transcript:ENSGGOT00000003368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWSLLLCGLSIALPLSVTADGCKDIFMKNEMLSASQPFAFNCTFPPITSGEVSVTWYKNS
SKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWCDT
SISGLPNLSDEYKQILHLGKDDSLTCHLHFPKSCVLGPIKWYKDCNEIKGERFTVLETRL
SVSNVSAEDRGNYACQAILTHSGKQYEVLNGITVSITERAGYGGSVPKIIYPKNHSIEVQ
LGTTLIVDCNITDTKDNTNLRCWRVNNTLVDDYYDESKRIREGVETHVSFREHNLYTVNI
TFLEVKMEDYGLPFVCHAGVSTAYIILQLPAPDFRAYLIGGLIALVAVAVSVLYIYNIFK
IDIVLWYRSAFHSTETIVDGKLYDAYVLYPKPHKESQRHAVDALVLKILPEVLERQCGYK
LFIFGRDEFPGQAVANVIDENVKLCRRLIVIVVPEPLGFGLLKNLSEEQIAVYNALIQDG
MKVILIELEKIEDYTVMPESIQYIKQKHGAIRWHGDFTEQSQCMKTKFWKTVRYHMPPRR
CRPSPPVQLPQHTPCYRTAGPELGSRRKKCTLTTG
Download sequence
Identical sequences G3QLE3
ENSGGOP00000003293 ENSGGOP00000003293 XP_004031572.1.27298

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]