SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003348 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003348
Domain Number 1 Region: 233-484
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-71
Family Eukaryotic proteases 0.00007
Further Details:      
 
Domain Number 2 Region: 104-216
Classification Level Classification E-value
Superfamily Kringle-like 8.22e-32
Family Kringle modules 0.00036
Further Details:      
 
Domain Number 3 Region: 1-40
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000104
Family EGF-type module 0.0067
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003348
Domain Number - Region: 38-76
Classification Level Classification E-value
Superfamily FnI-like domain 0.000262
Family Fibronectin type I module 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003348   Gene: ENSGGOG00000011172   Transcript: ENSGGOT00000003424
Sequence length 494
Comment pep:known_by_projection chromosome:gorGor3.1:4:3527835:3535422:1 gene:ENSGGOG00000011172 transcript:ENSGGOT00000003424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPCASGPCLNGGSCSNTQDPQSYHCSCPRAFTGKDCGTEKCFDETRYEYLEAGDRWARVR
QGHVEQCQCLGGRAWCGGTRRTACLSSPCLNGGTCHLIVATGTTMCACPPGFAGRLCNIE
PDERCFLGNGTGYHGVASTSASGLSCLAWNSDLLYQELHVDSVGAAALLGLGPHAYCRNP
DNDERPWCYLVKDSALSWEYCRLEACESLTRVQLSPDLLATLSEPASPGCQACGRRHKKR
TFLRPRIIGGSSLLPGSHPWLAAIYIGDSFCAGSLVHTCWVVSAAHCFSHSPPRDSVSVV
LGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRSQFVQPIC
LPEPGSTFPAGHKCQIAGWGHLDENVSGYSSSLREALVPLVADHKCSSPEVYGADISPNM
LCAGYFDCKSNACQEDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGVYTRVANYVDSI
NDRIRPPRWLVAPS
Download sequence
Identical sequences ENSGGOP00000003348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]