SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003407 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003407
Domain Number 1 Region: 64-166
Classification Level Classification E-value
Superfamily POZ domain 2.75e-18
Family Tetramerization domain of potassium channels 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003407   Gene: ENSGGOG00000003468   Transcript: ENSGGOT00000003484
Sequence length 368
Comment pep:known_by_projection chromosome:gorGor3.1:6:37496142:37507870:1 gene:ENSGGOG00000003468 transcript:ENSGGOT00000003484 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSLDYASQPANLQFPHIMPLAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHS
QAPEKVTLLVDGTRFVVNPQIFTAHPDTMLGRMFGPGREYNFTRPNEKGEYEIAEGISAT
VFRTVLDYYKTGIINCPDGISIPDLRDTCDYLCINFDFNTIRCQDLSALLHELSNDGAHK
QFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMGEEYSQNVFSKKLA
TWSSSLILEQNSVFKTFIFATFLIRVRLKFAGYPTCKEKIKRRPGGRSEVIYNYVQRPFI
QMSWEKEEGKSRHVDFQCVRSKSLTNLVAAGDDVLEDQEILMHHPPQVDELDRLNAPLSQ
MASNDFQD
Download sequence
Identical sequences ENSGGOP00000003407 ENSGGOP00000003407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]