SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003508 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003508
Domain Number 1 Region: 584-827
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.46e-80
Family Eukaryotic proteases 0.0000452
Further Details:      
 
Domain Number 2 Region: 88-218
Classification Level Classification E-value
Superfamily SEA domain 9.55e-22
Family SEA domain 0.0069
Further Details:      
 
Domain Number 3 Region: 234-353
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000000785
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 4 Region: 362-463
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000222
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 5 Region: 471-516
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000249
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 546-585
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000615
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 505-541
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000038
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003508   Gene: ENSGGOG00000003569   Transcript: ENSGGOT00000003588
Sequence length 831
Comment pep:known_by_projection chromosome:gorGor3.1:3:111324520:111370602:1 gene:ENSGGOG00000003569 transcript:ENSGGOT00000003588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKENSDVSAAPADLKISNISVQVVSAQKKLPPGRRPPQRPIGKAKPKKQSKKKVPFWNV
QNKIILFTVFLFILAVIAWTLLWLYISKTESKDAFYFAGMFRITNIEFLPEHRQKESREF
LSVSRTVQQVINLVYTTSAFSKFYEQSVVADVSSNNKGGLLVHFWIVFVMPRAKGHIFCE
DCVAAILKDSIQTSIINRTSVGSLQGLAVDMDSVVLNAGLRSDYSSTIGSADKVCSQYFY
AEHLSLHYPLEISAASGRLMCHFKLVAIVGYLIRLSIKSIQIEADNCVTDSLTIYDSLLP
IRSSILYRICEPTRTLMSFVSTNNLMLVTFKSPHIRRLSGIRAYFEVIPEQKCENTVLVK
DITGFEGKISSPYYPSYYPPKCKCTWKFQTSLSTLGIALKFYNYSITKKSMKGCEHGWWE
INEHMYCGSYMDHQTIFRVPSPLVHIQLQCSSRFSDKPLLVEYGSYNISQPCPVGSFRCS
SGLCVPQAQRCDGVNDCFDESDELFCVSPQPACNTSSFRQHGPLICDGFRDCENGRDEQN
CTQSIPCNNRSFKCGNDICFRKQNAKCDGTVDCPDGSDEEGCTCSRSSSALPRIIGGTDT
LEGGWPWQVSLHFVGSAYCGASVISREWLLSAAHCFHGNRLSDPTPWTAHLGMYVQGNAK
FVSPVRRIVVHEYYNSQTFDYDIALLQLSIAWPETLKQLIQPICIPPAGQRVRSGEKCWV
TGWGQRHEADNKGSLVLQQAEVELIDQTLCVSTYGIITSRMLCAGIMSGKRDACKGDSGG
PLSCRRKSDGKWILTGIVSWGHGCGRPNFPGVYTRVSNFVPWIHKYVPSLL
Download sequence
Identical sequences ENSGGOP00000003508 ENSGGOP00000003508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]