SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003536 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003536
Domain Number 1 Region: 11-106
Classification Level Classification E-value
Superfamily Immunoglobulin 1.26e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 221-308
Classification Level Classification E-value
Superfamily Immunoglobulin 5.09e-19
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 1318-1410
Classification Level Classification E-value
Superfamily Immunoglobulin 7.47e-18
Family I set domains 0.013
Further Details:      
 
Domain Number 4 Region: 1778-1861
Classification Level Classification E-value
Superfamily Immunoglobulin 1.85e-17
Family I set domains 0.023
Further Details:      
 
Domain Number 5 Region: 1589-1667
Classification Level Classification E-value
Superfamily Immunoglobulin 1.97e-17
Family I set domains 0.029
Further Details:      
 
Domain Number 6 Region: 1128-1228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000529
Family I set domains 0.034
Further Details:      
 
Domain Number 7 Region: 945-1040
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000083
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 767-857
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000167
Family I set domains 0.019
Further Details:      
 
Domain Number 9 Region: 855-950
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000226
Family I set domains 0.037
Further Details:      
 
Domain Number 10 Region: 1036-1122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000528
Family I set domains 0.055
Further Details:      
 
Domain Number 11 Region: 1415-1500
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000011
Family I set domains 0.017
Further Details:      
 
Domain Number 12 Region: 302-396
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000343
Family I set domains 0.019
Further Details:      
 
Domain Number 13 Region: 1687-1773
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000686
Family I set domains 0.0045
Further Details:      
 
Domain Number 14 Region: 1224-1319
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000546
Family I set domains 0.023
Further Details:      
 
Domain Number 15 Region: 127-208
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000194
Family I set domains 0.034
Further Details:      
 
Domain Number 16 Region: 1507-1595
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000291
Family I set domains 0.0032
Further Details:      
 
Domain Number 17 Region: 484-573
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000135
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 18 Region: 404-511
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000109
Family I set domains 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003536
Domain Number - Region: 588-661
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00103
Family I set domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003536   Gene: ENSGGOG00000003593   Transcript: ENSGGOT00000003616
Sequence length 1873
Comment pep:known_by_projection chromosome:gorGor3.1:2b:108509848:108539169:-1 gene:ENSGGOG00000003593 transcript:ENSGGOT00000003616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKASSGDQGSPPCFLRFPRPVRVVSGAEAELKCVVLGEPPPVVVWEKGGQQLAASERLSF
PADGAEHGLLLSAALPTDAGVYVCRARNAAGEAYAAAAVTVLEPPASDPELQPAERPLPS
PGSGEGAPVFLTGPRSQWVLRGAEVVLTCRAGGLPEPTLYWEKDGMALDEVWDSSHFALE
PGRAEDGPGASLALRILAARLPDSGVYEAPAPVVEPLKCAPKTFWVNEGKHAKFRCYVMG
KPEPEIEWHWEGRLLLPDRRRLMYRDRDGGFVLKVLYCQAKDRGLYVCAARNSAGQTLSA
VQLHVKEPRLRFTRPLQDVEGREHGIAVLECKVPNSRIPTAWFREDQRLLPCRKYEQIEE
GTVRRLIIHRLKADDDGIYLCEMRGRVRTVANVAVKGPILKGLPRKLDVLEGENAVLLVE
TLEAGVEGCWSRDGEELPVICQSSSGHMHALVLPGVTREDAGEVTFSLGNSRTTTLLRVK
CVKHSPPGPPISAEMFKGHKNTVLLTWKPPEPAPETPFIYRLERQEVGSEDWIQCFSIEK
AGAVEVPGDCVPSEGDYRFRICTVSGHGRSPHVVFHGSAHLVPTARLVAGLEDVQVYDGE
DAVFSLDLSTIIQGTWFLNGEELKSNEPEGQVEPGALRYRMEQKGLQHRLILHAVKHQDS
GALVGFSCPGVQDSAALTIQGWCRWGPEWAERVKTQKSCWQNEADAVFISCIWARRARSI
HASPCLPPAMLEPTTWRVAVSLLPLVGSSFTSCPPWGLSRNGGTSHPDPPVHIVDPREHV
FVHAITSECVMLACEVDREDAPVRWYKDGQEVEESDFVVLENEGPHRRLVLPATQPSDGG
EFQCVAGDERAYFTVTITDVSSWIVYPSGKVYVAAVRLERVVLTCELCRPWAEVRWTKDG
EEVVESPALLLQKEDTVRRLVLPAVQLEDSGEYLCEIDDESASFTVTVTEPPVRIIYPRD
EVTLIAVTLECVVLMCELSREDAPVRWYKDGLEVEESEALVLERDGPRCRLVLPAAQPED
GGEFVCDAGDDSAFFTVTVTAPPERIVHPAARSLDLHFGAPGRVELRCEVAPAGSQVRWY
KDGLEVEASDALQLGAEGPTRTLTLPHTQPEDAGEYVCETRDEAITFNVILAEPPVQFLA
PETTPSPLCVAPGEPVVLSCELSRAGAPVVWSHNGRPVQEGEGLELHAQGPRRVLCIQAA
GPAHAGLYTCQSGAAPGAPSLSFTVQVAEPPVRVVAPEAAQTRVRSTPGGDLELVVHLSG
PGGPVRWYKDGERLASQGRVQLDQAGARQVLRVQGTRSGDAGEYLCDAPQDSRIFLVSVE
EPLPVKLVSELTPLTVHEGDDATFRCEVSPPDADVTWLRNGAVVTPGPQVEMAQNGSSRI
LTLRGCQLGDAGAVTVRAGSTATSARLHVRETELLFLRRLQDVRAEEGQDVCLEVETGRV
GAAGAVRWVRGGQPLPNDSRLSMAQDGHIHRLFIHGVILADQGTYGCESHHDRTLARLSV
RPRQLRVLRPLEDVTISEGGSATFQLELSQEGVTGEWARGGVRLYPGPKCHIHSDGHRHQ
LVLNGLGLADSGCVSFTADSLRCAARLIVREVPVTIVRGPQDLEVTEGDTATFECELSQA
LADVTWEKDGSALTPSPRLRLQALGTRRLLQLRRCGPSDAGTYSCAVGMPRPAHAPGSAP
ERTVAVLSELRSVSTREGDGATFECTVSEVETTGRWELGGRPLRPGARVRIRQEGKKHIL
VLSELRAEDAGEVRFQAGPAQSLALLEVEALPLQMCRHPPREKTVLVGRRAVLEVTVSRS
GGHVCWLREGAELCPGDKYEMRSHGPTHSLVIHDVRPEDQGTYCCQAGRDSTHTRLLVEA
PCGVIPLQVTRRS
Download sequence
Identical sequences ENSGGOP00000003536 ENSGGOP00000003536

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]