SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003552 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003552
Domain Number 1 Region: 294-471
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.14e-59
Family SPRY domain 0.00000903
Further Details:      
 
Domain Number 2 Region: 33-144
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-20
Family V set domains (antibody variable domain-like) 0.00064
Further Details:      
 
Domain Number 3 Region: 158-232
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000194
Family C1 set domains (antibody constant domain-like) 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003552   Gene: ENSGGOG00000003612   Transcript: ENSGGOT00000003632
Sequence length 589
Comment pep:novel chromosome:gorGor3.1:6:27278404:27292965:1 gene:ENSGGOG00000003612 transcript:ENSGGOT00000003632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAAALHFSRQASLLLLLLLLLSLCALVSAQVTVVGPTNPILAMVGENTTLRCHLSPEE
NAEDMEVRWFQSQFSPAVFVYKGGRERTEEQKEEYRGRTTFVSKDSRGSVALVIHNVTEE
DNGIYQCYFQEGRSCNEAILHLVVAGLDSEPVIEMRDHEDGGIQLECISGGWYPKPLTVW
RDPYGEVVPALKEVSTPDADSLFMVTTAVIIRDKSVRNVSCSINDILLGQKKERVIFIPE
SFMPSRSSCVVILPVIMIILMIPIAICIYWINNLQKEKKDSHLMTFLCLSLAGWRRTFLH
AANVVLDPDTGHPYLFVSEDKRSVTLDPSRESMPDNPERFYSQLCVLGQESFASGRHYLE
VDMENVIEWTVGICRDNVERKWEDPLLPQNGFWTLEMHKRKYWTLTSPKWILSLEEPLCQ
VGVFLDYEAGDVSFYNMRDRSHIYTFPHSAFSVPVRPFFSLGSYESQILICSAFTGASGV
TVPEEGWTLHRAGTHRSPQYQFPSLTAIETSPGHLSSHCTMPLVEDTPSSPLVTQENIFQ
LPLSHPLQTSAPVHLLIRYGFSSSFGCNYRMESRHRELVVPQLPARKKV
Download sequence
Identical sequences ENSGGOP00000003552 ENSGGOP00000003552

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]