SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003581 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003581
Domain Number 1 Region: 396-527
Classification Level Classification E-value
Superfamily YWTD domain 5.75e-23
Family YWTD domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 103-144
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000654
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 3 Region: 142-184
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000288
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 4 Region: 282-394,531-577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000863
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 26-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000102
Family LDL receptor-like module 0.00011
Further Details:      
 
Domain Number 6 Region: 196-232
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000157
Family LDL receptor-like module 0.00013
Further Details:      
 
Domain Number 7 Region: 234-272
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.00012
Further Details:      
 
Domain Number 8 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003581   Gene: ENSGGOG00000003636   Transcript: ENSGGOT00000003661
Sequence length 725
Comment pep:known_by_projection chromosome:gorGor3.1:19:11301902:11344424:1 gene:ENSGGOG00000003636 transcript:ENSGGOT00000003661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPWGWKLRWTVALLLAAAGTAVGDRCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQ
ETCLSVTCKSEDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPRTCSQDEFRCHDGK
CISRQFVCDSDRDCLDGSDEASCPVLTCGPASFQCNSSTCIPQLWACDNDPDCEDGSDEW
PQHCRGLYVFQGDSSPCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEENCAVATCRPDE
FQCSDGNCIHGSRQCDREYDCKDMSDEVGCVNVTLCEGPNKFKCHSGECITLDKVCNMAR
DCRDWSDEPIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQLVAQRRCEDIDECQD
PDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVFMYWTDWGTPAKIKKGGLNGVDIYS
LVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTVLEDEKRLAHPFSLAVF
EDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTILSN
GGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCLTEAEAAVATQETSTVRLKVSST
AVRTQHTTTRPVPDTSRLPGATPGLTTVEIVTTSHQALGDVAGRGNEKPSGVRALSIVLP
IVLLVFLCLGAFLLWKNWRLKNINSINFDNPVYQKTTEDEVHICRNQDGYSYPSRQMVSL
EDDVA
Download sequence
Identical sequences ENSGGOP00000003581

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]