SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003626 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003626
Domain Number 1 Region: 270-451
Classification Level Classification E-value
Superfamily Kelch motif 1.26e-54
Family Kelch motif 0.00000911
Further Details:      
 
Domain Number 2 Region: 397-560
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-45
Family Kelch motif 0.0000265
Further Details:      
 
Domain Number 3 Region: 14-133
Classification Level Classification E-value
Superfamily POZ domain 1.65e-35
Family BTB/POZ domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003626   Gene: ENSGGOG00000003685   Transcript: ENSGGOT00000003709
Sequence length 574
Comment pep:known_by_projection chromosome:gorGor3.1:3:48512015:48578839:1 gene:ENSGGOG00000003685 transcript:ENSGGOT00000003709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVEDGAEELEDLVHFSVSELPSRGYGVMEEIRRQGKLCDVTLKIGDHKFSAHRIVLAASI
PYFHAMFTNDMMECKQDEIVMQGMDPSALEALINFAYNGNLAIDQQNVQSLLMGASFLQL
QSIKDACCTFLRERLHPKNCLGVRQFAETMMCAVLYDAANSFIHQHFVEVSMSEEFLALP
LEDVLELVSRDELNVKSEEQVFEAALAWVRYDREQRGPYLPELLSNIRLPLCRPQFLSDR
VQQDDLVRCCHKCRDLVDEAKDYHLMPERRPHLPAFRTRPRCCTSIAGLIYAVGGLNSAG
DSLNVVEVFDPIANRWERCRPMTTARSRVGVAVVNGLLYAIGGYDGQLRLSTVEAYNPET
DTWTRVGSMNSKRSAMGTVVLDGQIYVCGGYDGNSSLSSVETYSPETDKWTVVTSMSSNR
SAAGVTVFEGRIYVSGGHDGLQIFSSVEHYNHHTATWHPAAGMLNKRCRHGAASLGSKMF
VCGGYDGSGFLSIAEMYSSVADQWCLIVPMHTRRSRVSLVASCGRLYAVGGYDGQSNLSS
VEMYDPETDRWTFMAPMACHEGGVGVGCIPLLTI
Download sequence
Identical sequences K7CDY2
9598.ENSPTRP00000025637 ENSPTRP00000025637 ENSGGOP00000003626 ENSGGOP00000003626 ENSPTRP00000025637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]