SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003644 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003644
Domain Number 1 Region: 42-134
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000802
Family I set domains 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003644   Gene: ENSGGOG00000003709   Transcript: ENSGGOT00000003727
Sequence length 289
Comment pep:known_by_projection chromosome:gorGor3.1:3:111738171:111771788:-1 gene:ENSGGOG00000003709 transcript:ENSGGOT00000003727 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPV
KYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQ
SNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYSLLPLGGLPLLITTCFCLFCCLRR
HQGKQNELSDTAGREITLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGS
EVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Download sequence
Identical sequences A0A2I2Y8S3 H2R071
ENSPTRP00000040260 ENSPTRP00000040260 ENSGGOP00000003644 XP_001154904.1.37143 XP_004036104.1.27298 ENSGGOP00000003644 9598.ENSPTRP00000040260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]