SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003648 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003648
Domain Number 1 Region: 2-120
Classification Level Classification E-value
Superfamily POZ domain 3.92e-31
Family BTB/POZ domain 0.0009
Further Details:      
 
Domain Number 2 Region: 609-659
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000073
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003648   Gene: ENSGGOG00000003712   Transcript: ENSGGOT00000003731
Sequence length 677
Comment pep:known_by_projection chromosome:gorGor3.1:9:38225359:38252540:-1 gene:ENSGGOG00000003712 transcript:ENSGGOT00000003731 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFPGHFEQIFQQLNYQRLHGQLCDCVIVVGNRHFKAHRSVLAACSTHFRALFSVAEGDQ
TMNMIQLDSEVVTAEAFAALIDMMYTSTLMLGESNVMDVLLAASHLHLNSVVKACKHYLT
TRTLPMSPPSERVQEQSARMQRSFMLQQLGLSIVSSALNSSQNGEEQPAPMSSSMRSNLD
QRTPFPMRRLHKRKQSAEERARQRLRPSMDESAISDVTPENGPSGVHSREEFFSPDSLKI
VDNPKADGMTDNQEDSAIMFDQSFGTQEDAQVPSQSDNSAGNMAQLSMASRATQVETSFD
QEAAPEKSSFQCENPEVGLGEKEHMRVVVKSEPLSSPEPQDEVSDVTSQAEGSESVEVEG
VVVSAEKIDLSPESSDRSFSDPQSSTDRVGDIHILEVTNNLEHKSTFSISNFLNKSRGNN
FTANQNNDDNIPNTTSDCRLESEAPYLLSPEAGPAGGPSSAPGSHVENPFSEPADSHFVR
PMQEVMGLPCVQTSGYQGGEQFGMDFSRSGLGLHSSFSRVMIGSPRGGASNFPYYRRIAP
KMPVVTSVRSSQIPENSTSSQLMMNGATSSFENGHPSQPGPPQLTRASADVLSKCKKALS
EHNVLVVEGARKYACKICCKTFLTLTDCKKHIRVHTGEKPYACLKCGKRFSQSSHLYKHS
KTTCLRWQSSNLPSTLL
Download sequence
Identical sequences XP_003805173.1.60992 XP_014201634.1.60992 XP_014201635.1.60992 ENSGGOP00000003648 ENSGGOP00000003648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]