SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003652 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003652
Domain Number 1 Region: 393-674
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-100
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000352
Further Details:      
 
Domain Number 2 Region: 633-933
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-83
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000813
Further Details:      
 
Domain Number 3 Region: 5-200
Classification Level Classification E-value
Superfamily Fibronectin type III 4.95e-29
Family Fibronectin type III 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSGGOP00000003652
Domain Number - Region: 218-255,308-356
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0126
Family Fibronectin type III 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003652   Gene: ENSGGOG00000003702   Transcript: ENSGGOT00000003735
Sequence length 935
Comment pep:known_by_projection chromosome:gorGor3.1:18:8145926:8477502:1 gene:ENSGGOG00000003702 transcript:ENSGGOT00000003735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLTVHYCYQVGGQEQVREEVSWDTE
NSHPQHTITNLSPYTNVSVKLILMNPEGRKESQELIVQTDEDLPGAVPAESIQGSTFEEK
IFLQWREPTQTYGVITLYEITYKAVSSFDPEIDLSNQSGRVSKLGNETHFLFFGLYPGTT
YSFTIRASTAKGFGPPATNQFTTKISAPSMPAYELETPLNQTDNTVTVMLKPAHSRGAPV
SVYQIVVEEERPRRTKKTTEILKCYPVPIHFQNASLLNSQYYFAAEFPADSLQAAQPFTI
GDNKTYNGYWNTPLLPYKSYRIYFQAASRANGETKIDCVQVATKGAATPKPVPEPEKQTD
HTVKIAGVIAGILLFVIIFLGVVLVMKKSFFEGQSAPWDSAKKDENRMKNRYGNIIAYDH
SRVRLQTIEGDTNSDYINGNYIDGYHRPNHYIATQGPMQETIYDFWRMVWHENTASIIMV
TNLVEVGRVKCCKYWPDDTEIYKDIKVTLIETELLAEYVIRTFAVEKRGVHEIREIRQFH
FTGWPDHGVPYHATGLLGFVRQVKSKSPPSAGPLVVHCSAGAGRTGCFIVIDIMLDMAER
EGVVDIYNCVRELRSRRVNMVQTEEQYVFIHDAILEACLCGDTSVPASQVRSLYYDMNKL
DPQTNSSQIKEEFRTLNMVTPTLRVEDCSIALLPRNHEKNRCMDILPPDRCLPFLITIDG
ESSNYINAALMDSYKQPSAFIVTQHPLPNTVKDFWRLVLDYHCTSVVMLNDVDPAQLCPQ
YWPENGVHRHGPIQVEFVSADLEEDIISRIFRIYNAARPQDGYRMVQQFQFLGWPMYRDT
PVSKRSFLKLIRQVDKWQEEYNGGEGRTVVHCLNGGGRSGTFCAISIVCEMLRHQRTVDV
FHAVKTLRNNKPNMVDLLDQYKFCYEVALEYLNSG
Download sequence
Identical sequences ENSGGOP00000003652 ENSGGOP00000003652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]