SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003657 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003657
Domain Number 1 Region: 3-50
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 1.44e-20
Family Ribosomal protein L39e 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003657   Gene: ENSGGOG00000016803   Transcript: ENSGGOT00000003740
Sequence length 51
Comment pep:known_by_projection chromosome:gorGor3.1:3:188587626:188607409:-1 gene:ENSGGOG00000016803 transcript:ENSGGOT00000003740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSHKTFTIKRFLAKKQKQNRPIPQWIQMKPGNKIRYNSKRRHWRRTKLGL
Download sequence
Identical sequences A0A0D9SC58 A0A2I2YLB6 A0A2I3HXY3 A0A2K5HJN1 A0A2K6AMY3 A0A2K6KK96 A0A2K6NIK3 F7GHP0 G7NYN4
9544.ENSMMUP00000026663 ENSNLEP00000008129 ENSMMUP00000026663 XP_003256674.1.23891 XP_004038225.1.27298 XP_005545504.1.63531 XP_014987925.1.72884 XP_017728899.1.44346 XP_018879678.1.27298 ENSMMUP00000026663 ENSGGOP00000003657 ENSGGOP00000003657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]