SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003676 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003676
Domain Number 1 Region: 275-554
Classification Level Classification E-value
Superfamily Kelch motif 3.92e-71
Family Kelch motif 0.0000249
Further Details:      
 
Domain Number 2 Region: 12-132
Classification Level Classification E-value
Superfamily POZ domain 6.48e-34
Family BTB/POZ domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003676   Gene: ENSGGOG00000003740   Transcript: ENSGGOT00000003762
Sequence length 558
Comment pep:known_by_projection chromosome:gorGor3.1:2b:57502056:57556635:1 gene:ENSGGOG00000003740 transcript:ENSGGOT00000003762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKGQEDYIYLFKDSTHPVDFLDAFRTFYLDGLFTDITLQCPSGIIFHCHRAVLAACSN
YFKAMFTADMKEKFKNKIKLSGIHHDILEGLVNYAYTSQIEITKRNVQSLLEAADLLQFL
SVKKACERFLVRHLDIDNCIGMHSFAEFHVCPELEKESRRILCSKFKEVWQQEEFLEISL
EKFLFILSRKNLSVWKEEAIIEPVIKWTAHDVENRIECLYNLLSYINIDIDLVYLKTALG
LQRSCLLTENKIRSLIYNALNPMHREISQRSTATMYIIGGYYWHPLSEVHIWDPLTNVWI
QGAEIPDYTRESYGVTCLGPNIYVTGGYRTDNIEALDTVWIYNSESDEWTEGLPMLNARY
YHCAVTLGGCVYALGGYRKGAPAEEAEFYDPLKEKWIPIANMIKGVGNATACVLHDVIYV
IGGHCGYRGSCTYDKVQSYNSDINEWSLITSSPHPEYGLCSVPFENKLYLVGGQTTITEC
YDPEQNEWREIAPMMERRMECGAVIMNGCIYVTGGYSYSKGTYLQSIEKYDPDLNKWEIV
GNLPSAMRSHGCVCVYNV
Download sequence
Identical sequences G3QMD8
ENSGGOP00000003676 XP_004032808.1.27298 ENSGGOP00000006107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]