SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGGOP00000003685 from Gorilla gorilla 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGGOP00000003685
Domain Number 1 Region: 753-919
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-47
Family MAM domain 0.00022
Further Details:      
 
Domain Number 2 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 3.11e-17
Family I set domains 0.0054
Further Details:      
 
Domain Number 3 Region: 438-542
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000918
Family I set domains 0.031
Further Details:      
 
Domain Number 4 Region: 343-442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000488
Family I set domains 0.043
Further Details:      
 
Domain Number 5 Region: 48-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000117
Family I set domains 0.069
Further Details:      
 
Domain Number 6 Region: 540-634
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000687
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 131-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000811
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 194-240,635-743
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000552
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGGOP00000003685   Gene: ENSGGOG00000003747   Transcript: ENSGGOT00000003772
Sequence length 958
Comment pep:known_by_projection chromosome:gorGor3.1:6:38686669:38755037:-1 gene:ENSGGOG00000003747 transcript:ENSGGOT00000003772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQC
LVTGHPRPQVRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIK
SIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDIYEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTAPP
ALKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQA
QDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVD
AVPQEKVTYQWFKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCMASFP
GAPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDK
EAALLPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRPREAQVQLNVQSPPV
PPEVEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDH
AELRLDAVTRDSSGSYECSVSNDVGSAACLFQVSAKAYSPEFYFDTPNPTRSHKLSKNYS
YVLQWTQREPDAVDPVLNYRLSIRQLNQHNAVVKAIPVRRVEKGQLLEYILTDLRVPHSY
EVRLTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCHFEDEKICGYTQDLTDNFDWTRQN
ALTQNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFF
YHMYGKHIGSLNLLVRSRNKGALDTHAWSLSGNKGNVWQQAHVPISPSGPFQIIFEGVRG
PGYLGDIAIDDVTLKKGECPRKQTDPNKVVVMPGSGVSCQSSPQLWGPMAIFLLALQR
Download sequence
Identical sequences ENSGGOP00000003685 ENSGGOP00000003685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]